KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_1153Help
Entry
SYO3AOP1_1153     CDS       T00715                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYO3AOP1_1153 (tpiA)
   01230 Biosynthesis of amino acids
    SYO3AOP1_1153 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYO3AOP1_1153 (tpiA)
   00051 Fructose and mannose metabolism
    SYO3AOP1_1153 (tpiA)
   00562 Inositol phosphate metabolism
    SYO3AOP1_1153 (tpiA)
Enzymes [BR:sul01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SYO3AOP1_1153 (tpiA)
Exosome [BR:sul04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SYO3AOP1_1153 (tpiA)
  Exosomal proteins of bladder cancer cells
   SYO3AOP1_1153 (tpiA)
  Exosomal proteins of melanoma cells
   SYO3AOP1_1153 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1201825..1202577
Genome map
AA seq 250 aa AA seqDB search
MRYLIAANWKMNKTVAESVEYIEKFKPMVEDIHQVDIMIAPSFTALSSASLELSKTNIKL
GAQNMYHVDRGAFTGEISPIMLKELNVEYVILGHSERRYIFGEKDELINKKVISALEYGI
RPIVCVGETLEERELGITLNVVERQIKMAFAGVYPEIGLCDIAYEPVWAIGTGKNATKEQ
AQEVHHFIRTLINELSKGNDETTRILYGGSVNENNAKDLISQKNVDGFLVGTASLDPVKF
YKIITHSLEV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagatatcttatagctgcaaactggaagatgaacaaaacagttgcagaatccgtagag
tacatagaaaaattcaaacctatggttgaagatatccatcaagttgatattatgatagcc
ccatcttttacagctttatcttcagcttctttagagcttagcaagacaaatataaaactt
ggtgctcaaaatatgtatcatgtagatagaggggcttttactggtgagatatcgccaata
atgttgaaagagttaaacgttgagtatgtaatccttggacattctgaaagaagatatatt
tttggagaaaaggacgagcttataaataaaaaagttatatctgcattagaatatggaata
agaccgatagtttgcgttggagagacattggaagaaagagagcttggaataacattaaac
gttgtagaaagacagataaaaatggcttttgctggtgtttatcctgagattggtctttgt
gatatagcttatgaacccgtctgggctattggaacagggaagaatgcaacaaaagagcaa
gcccaagaagttcatcattttattagaactcttataaatgaactgtctaaaggaaatgat
gagactacaaggattttatacggtggtagtgttaacgaaaataacgcaaaagatttgata
agtcaaaaaaatgttgatggatttttggttggtacagcaagcttagaccctgtaaaattt
tataaaatcattacccattctttggaggtgtag

DBGET integrated database retrieval system