KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_1153Help
Entry
SYO3AOP1_1153     CDS       T00715                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
sul00010  Glycolysis / Gluconeogenesis
sul00051  Fructose and mannose metabolism
sul00562  Inositol phosphate metabolism
sul01100  Metabolic pathways
sul01110  Biosynthesis of secondary metabolites
sul01120  Microbial metabolism in diverse environments
sul01130  Biosynthesis of antibiotics
sul01200  Carbon metabolism
sul01230  Biosynthesis of amino acids
Module
sul_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sul_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYO3AOP1_1153
   00051 Fructose and mannose metabolism
    SYO3AOP1_1153
   00562 Inositol phosphate metabolism
    SYO3AOP1_1153
Enzymes [BR:sul01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SYO3AOP1_1153
Exosome [BR:sul04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SYO3AOP1_1153
  Exosomal proteins of bladder cancer cells
   SYO3AOP1_1153
  Exosomal proteins of melanoma cells
   SYO3AOP1_1153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM PEP_hydrolase
Motif
Other DBs
NCBI-ProteinID: ACD66765
JGI: SYO3AOP11153
UniProt: B2V9Z2
Position
1201825..1202577
Genome map
AA seq 250 aa AA seqDB search
MRYLIAANWKMNKTVAESVEYIEKFKPMVEDIHQVDIMIAPSFTALSSASLELSKTNIKL
GAQNMYHVDRGAFTGEISPIMLKELNVEYVILGHSERRYIFGEKDELINKKVISALEYGI
RPIVCVGETLEERELGITLNVVERQIKMAFAGVYPEIGLCDIAYEPVWAIGTGKNATKEQ
AQEVHHFIRTLINELSKGNDETTRILYGGSVNENNAKDLISQKNVDGFLVGTASLDPVKF
YKIITHSLEV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagatatcttatagctgcaaactggaagatgaacaaaacagttgcagaatccgtagag
tacatagaaaaattcaaacctatggttgaagatatccatcaagttgatattatgatagcc
ccatcttttacagctttatcttcagcttctttagagcttagcaagacaaatataaaactt
ggtgctcaaaatatgtatcatgtagatagaggggcttttactggtgagatatcgccaata
atgttgaaagagttaaacgttgagtatgtaatccttggacattctgaaagaagatatatt
tttggagaaaaggacgagcttataaataaaaaagttatatctgcattagaatatggaata
agaccgatagtttgcgttggagagacattggaagaaagagagcttggaataacattaaac
gttgtagaaagacagataaaaatggcttttgctggtgtttatcctgagattggtctttgt
gatatagcttatgaacccgtctgggctattggaacagggaagaatgcaacaaaagagcaa
gcccaagaagttcatcattttattagaactcttataaatgaactgtctaaaggaaatgat
gagactacaaggattttatacggtggtagtgttaacgaaaataacgcaaaagatttgata
agtcaaaaaaatgttgatggatttttggttggtacagcaagcttagaccctgtaaaattt
tataaaatcattacccattctttggaggtgtag

DBGET integrated database retrieval system