KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_1213Help
Entry
SYO3AOP1_1213     CDS       T00715                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sul00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sul00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1264108..1265601
Genome map
AA seq 497 aa AA seqDB search
MKLLKEILTDEKIIYGNQETVIEGITNNSKKVEKNYAFFAIKGTSVDGHNFIDEAIKNGA
SVIFIEDEKYVESLKGKNITVVLTDNGRKSLALASNRFYDNPSEKLKVIAITGTNGKTTT
SNLLAQYYEMAGYKVGVIGTINYRVGDEILSSGHTTPDPVEWFKTLKVMKDKGADVVVAE
VSSHAADQYRVYSTKFHGGIFTNLTQDHLDYHQTMENYFLAKRRIFEQIDEFNKEAIYSI
NVDDEYGRRILDYLKNHLKVNDDKIITYGKTSEDFKILDYRLSLFETEFSYKYKDTLSKI
KTKLRGVFNIYNLSAAVSFLIKDGFDLKFLEEKALHLKPIKGRFEVIEGQGFIVVIDYAH
TPDALENILKSLNEIKENRIIAVFGAGGNRDKTKRPLMGETAEKLSDIVILTSDNPRNED
PLSIIEDILDGIKDKDKVITIVDRKQAIEKAISLAKEKDIILIAGKGHENYQIIGDKILH
FDDAEVVKEIIDGGKGV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaaattactaaaagagatattaacagatgaaaaaataatttatggaaatcaagagaca
gttatagaaggaattacaaataacagcaaaaaagtcgagaagaattacgcattttttgcc
attaaaggcacatcggtagatggtcataactttattgacgaagctataaaaaatggtgca
tctgtaatttttatagaagatgaaaagtatgttgaaagtttaaaaggaaaaaatataact
gttgttttgacagataacggcagaaagtctttagctttggcttcaaacaggttttatgat
aatccatctgaaaagttaaaagtgatagcaattactggaacaaatggaaagactacaaca
tcaaacttacttgcccagtattatgaaatggccgggtataaagttggtgtaatcgggaca
atcaattacagagttggagatgagatattatcttcaggacatacaacgccagacccagta
gaatggtttaaaacacttaaagtaatgaaagataaaggggcggatgtagtagttgcagaa
gtttcttcccatgcagcagaccagtatagagtttattcaacaaagtttcatggtggaatt
tttacgaatctaacacaagaccatcttgattatcaccaaacaatggaaaattacttctta
gcaaaaagaagaatttttgagcagattgatgaattcaataaagaagcaatttacagcata
aatgtagatgatgagtatggaagaagaatcttagattatctaaaaaaccatttaaaagtc
aatgatgacaaaatcattacatacggaaaaacatcagaagattttaagattcttgattat
agactttcactttttgagactgaatttagctataaatataaagatacattaagcaaaatc
aaaacaaaattgagaggggtttttaatatttataatctatctgctgccgtttcttttctt
ataaaagatggttttgatttgaaattcttagaagaaaaagcattacatctaaagccgatt
aaaggaaggtttgaagtaatagaagggcaaggttttatagttgttatagattatgcccat
acaccggatgcacttgaaaacattttaaaatcgttaaatgaaatcaaagaaaatagaatc
atagcagtgtttggagcaggtggcaacagagacaagacaaaaagaccattgatgggagag
acggcagaaaaactatctgatattgtaattctaacatctgataatccaagaaatgaagac
ccattaagtataatagaagatatcttagatggaataaaagataaagacaaagtaataact
attgtagatagaaaacaggcaatagaaaaagctatcagtttagcaaaagaaaaagatata
attttaatagcagggaaaggacatgaaaattatcagataattggcgataaaatattgcat
tttgacgatgcagaagtagtaaaagaaattatagacggaggaaaaggtgtttag

DBGET integrated database retrieval system