KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_1265Help
Entry
SYO3AOP1_1265     CDS       T00715                                 

Definition
Acireductone dioxygenase ARD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:sul00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1309842..1310381)
Genome map
AA seq 179 aa AA seqDB search
MARLVFRKNGKVIENPEEIKSFLSQYGVVYDVWGVDRLPEDVRKNYDIDEENSKAIIQAY
EKELKELKEKMGYITEDIVVLSEKTPNLDGLMAKFKREHHHIDDEVRFVVDGSGIFPVKI
EDDIVDIHVEAGELIVVPAGARHWFELDENRKIKCIRVFKTPAGWEAIYNENETATMRD
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcaagattagttttcagaaaaaacggtaaggtaatagaaaatcccgaagagataaaa
tcatttttgtctcagtatggtgtagtttatgacgtttggggcgttgatagacttccggaa
gatgttagaaaaaattacgacatagatgaagaaaactcaaaagccataatccaagcatac
gaaaaagaattaaaagaattgaaagaaaaaatgggatacattacagaagatatagttgtt
ttatctgaaaaaactccaaatcttgatggtctaatggctaaatttaaaagagagcatcac
catatagatgatgaagttagatttgtagttgatggtagtggtatatttccggtaaaaata
gaagatgatattgtagatattcatgtagaagctggggagttaatcgttgtgccggcggga
gcaagacactggtttgagcttgacgaaaacagaaaaataaaatgtataagagttttcaaa
acacctgcaggttgggaagctatttacaatgaaaatgaaacagcaactatgagggactaa

DBGET integrated database retrieval system