KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_1322Help
Entry
SYO3AOP1_1322     CDS       T00715                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sul01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sul00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1359538..1360320
Genome map
AA seq 260 aa AA seqDB search
MNILDKIIQTKREELENYTSQYLKHLEKLAIERNKKVLNFKKAISGKSINIIAEVKKASP
SKGIIRHYFDPVDIAKSYEKNGAKAISVLTDKQYFQGDIAYLYQISTEVNIPLLRKDFII
DERQILEAYAYGADSYLLIAKVLDKESLKRLIDFGRELDMEPLVEVHSREEGEKSVEAGA
RIIGINNRNLEDFTVDINLSKELAPYLKEIGSEVVVAESGLESRQQLLELKNYQVDAFLI
GESLMKEADVGKKLREFIEG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaatatattagacaagattattcagacaaaaagagaagagcttgaaaattacacttct
cagtatttaaaacatttagaaaaactggcaatagaaagaaataaaaaagtcttaaacttt
aaaaaagccatttccggaaagagtatcaatattattgcagaagttaaaaaagcttctccg
tctaaaggaataatcagacattattttgaccctgttgatatagcaaaatcttatgaaaaa
aatggagcaaaagcaatttctgtactaacagataaacagtattttcaaggagatattgcg
tatctttatcaaatttcaacagaagtaaatattccattgcttagaaaagactttatcata
gatgaaaggcagattttggaagcttatgcatatggtgctgatagttatctattaatagca
aaagtcttggataaagaaagtttaaagagacttatagattttggaagagagcttgacatg
gagccattggtagaagttcacagtagagaagaaggtgaaaaatctgtagaagcaggagca
agaattattggaataaataatagaaatttggaagattttacagttgatataaatctatca
aaagagcttgcaccgtatctaaaagagatcggatctgaagttgtagttgcagaaagcgga
ttagagagcagacaacagctgcttgagttgaaaaattatcaagttgacgcatttttaata
ggagaatctttaatgaaagaagcagatgtaggaaagaagttaagagagtttatagaaggg
taa

DBGET integrated database retrieval system