KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_1322Help
Entry
SYO3AOP1_1322     CDS       T00715                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
sul00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sul01100  Metabolic pathways
sul01110  Biosynthesis of secondary metabolites
sul01130  Biosynthesis of antibiotics
sul01230  Biosynthesis of amino acids
Module
sul_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SYO3AOP1_1322
Enzymes [BR:sul01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SYO3AOP1_1322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C PDZ
Motif
Other DBs
NCBI-ProteinID: ACD66932
JGI: SYO3AOP11322
UniProt: B2V5I8
Position
1359538..1360320
Genome map
AA seq 260 aa AA seqDB search
MNILDKIIQTKREELENYTSQYLKHLEKLAIERNKKVLNFKKAISGKSINIIAEVKKASP
SKGIIRHYFDPVDIAKSYEKNGAKAISVLTDKQYFQGDIAYLYQISTEVNIPLLRKDFII
DERQILEAYAYGADSYLLIAKVLDKESLKRLIDFGRELDMEPLVEVHSREEGEKSVEAGA
RIIGINNRNLEDFTVDINLSKELAPYLKEIGSEVVVAESGLESRQQLLELKNYQVDAFLI
GESLMKEADVGKKLREFIEG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaatatattagacaagattattcagacaaaaagagaagagcttgaaaattacacttct
cagtatttaaaacatttagaaaaactggcaatagaaagaaataaaaaagtcttaaacttt
aaaaaagccatttccggaaagagtatcaatattattgcagaagttaaaaaagcttctccg
tctaaaggaataatcagacattattttgaccctgttgatatagcaaaatcttatgaaaaa
aatggagcaaaagcaatttctgtactaacagataaacagtattttcaaggagatattgcg
tatctttatcaaatttcaacagaagtaaatattccattgcttagaaaagactttatcata
gatgaaaggcagattttggaagcttatgcatatggtgctgatagttatctattaatagca
aaagtcttggataaagaaagtttaaagagacttatagattttggaagagagcttgacatg
gagccattggtagaagttcacagtagagaagaaggtgaaaaatctgtagaagcaggagca
agaattattggaataaataatagaaatttggaagattttacagttgatataaatctatca
aaagagcttgcaccgtatctaaaagagatcggatctgaagttgtagttgcagaaagcgga
ttagagagcagacaacagctgcttgagttgaaaaattatcaagttgacgcatttttaata
ggagaatctttaatgaaagaagcagatgtaggaaagaagttaagagagtttatagaaggg
taa

DBGET integrated database retrieval system