KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_1365Help
Entry
SYO3AOP1_1365     CDS       T00715                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sul00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SYO3AOP1_1365
DNA repair and recombination proteins [BR:sul03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SYO3AOP1_1365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1401805..1402407)
Genome map
AA seq 200 aa AA seqDB search
MNIVPETIQQVISEISRLPGYGEKTAQRLAVNLLKMPKGEAVDLVRHLALMLDKVHLCRE
CGIFTEKEICDVCSDESRDRSVICVVEESFDAFMIENTGKYSGLYHVLGGRLSPLEGIGP
EKLNIKSLIDRIKKLNVKEIIFATNPTVEGEATANYIHNLIKNYPITISRLAYGLPFGGV
LENADDFTLAKALENKQILK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttgaatatagttccggagactattcagcaggttatatcggaaatatctagactaccaggt
tatggagaaaagacagcccaaagattagctgtcaatctattaaaaatgcccaaaggtgaa
gcggtagaccttgtaagacacttggctttaatgcttgacaaagttcatctttgcagagaa
tgcggaatttttacagaaaaagaaatttgcgatgtatgtagtgatgaaagtagagatagg
tctgttatctgtgtagttgaagagtcttttgatgcttttatgattgaaaatacaggcaaa
tacagcggactttatcatgttttaggcggaaggctttctccattagagggaataggtcca
gaaaagctaaacataaaatctttgattgacagaataaaaaaattaaatgtaaaagaaatt
atctttgcaacaaatccaacagtagaaggcgaagcaacagcaaattatatacataatttg
ataaaaaactatcctataaccatctcaagattagcttatggcttaccttttggcggagta
ttagaaaatgcagatgattttacattagccaaagcattggaaaataaacagattttgaag
tga

DBGET integrated database retrieval system