KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_1587Help
Entry
SYO3AOP1_1587     CDS       T00715                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
sul00010  Glycolysis / Gluconeogenesis
sul00620  Pyruvate metabolism
sul00640  Propanoate metabolism
sul00680  Methane metabolism
sul00720  Carbon fixation pathways in prokaryotes
sul01100  Metabolic pathways
sul01110  Biosynthesis of secondary metabolites
sul01120  Microbial metabolism in diverse environments
sul01130  Biosynthesis of antibiotics
sul01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYO3AOP1_1587
   00620 Pyruvate metabolism
    SYO3AOP1_1587
   00640 Propanoate metabolism
    SYO3AOP1_1587
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SYO3AOP1_1587
   00680 Methane metabolism
    SYO3AOP1_1587
Enzymes [BR:sul01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SYO3AOP1_1587
Lipid biosynthesis proteins [BR:sul01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SYO3AOP1_1587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACD67185
JGI: SYO3AOP11587
UniProt: B2V6B2
Position
complement(1639825..1641723)
Genome map
AA seq 632 aa AA seqDB search
MENLETVHLQVKDIYYPPEEIKKECIVQNYEEMYKKSIENPDEFWSEVANELFWYQKWDK
VLEWNFPYAKWFVGGKTNITYNCLDRHVLNGKRNKVAYIYVDEDENEKKITYGELLELVN
RLANGLKSLGVGKGDRVSIYMPNTIEAIASMLACARIGAIHSVVFAGFSEGALKLRINDA
KAKVVITATYTKRRGKKIPLLPTVKDAIKELDFVKKVIVWDRDNELSEEEYGSHYINFQK
LIKSSSPVCDPEVMDAEDPLFILYTSGTTGKPKGVLHTTGGYMVNTYLTTKTVFNIKEDT
IYWCTADIGWITGHSYIVYGPLANGTTSVIMEGVPVYPHPGIWWEYVEKYRVNVFYTAPT
AIRMLMRFGDEIPAKYDLSSLKILGSVGEPINPEAWIWYYKNIGKEKAAVVDTWWQTETG
AHMITTLPCYPAKPGKAGKPLFGVVPAVVDKEGNELPPNTVGHLVIKKPWPSMLRTCWGE
PERYEKYWKEIPGGVYSAGDLASVDEDGYIMILGRADDVLSVAGHRIGNAEVESAIVEHP
AVAEAAVIGKPNEIKGESIKAFVILKEGYSPSQELIIEIKETVKDVLGAIAVPDEVEFVD
KLPKTRSGKIMRRVLRARELGQELGDISTLED
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatttagaaacagttcatttacaagtaaaggatatttattatccaccggaggag
attaaaaaagagtgtatagttcaaaactacgaagagatgtataaaaaatctattgaaaat
cctgatgaattttggtctgaagttgcaaatgaactattttggtatcaaaagtgggataag
gttttagagtggaattttccttatgctaaatggtttgttggcgggaaaacaaacatcaca
tacaactgtcttgatagacatgttttaaacggaaaaagaaataaagtagcttatatttac
gttgatgaagacgaaaacgaaaaaaaaataacctatggcgagcttttggagcttgttaat
agacttgcaaatggcttgaaatcccttggtgttggcaaaggggatagagtttctatttat
atgccaaatactattgaagcaatagcaagtatgcttgcttgtgcaaggattggagctata
catagtgtagtttttgcaggatttagcgaaggggcattgaaattaagaatcaatgatgca
aaagcaaaagtagtaataacagcaacctacacaaaaagaaggggtaaaaaaataccatta
cttccaactgtaaaagatgcaattaaagagcttgattttgttaaaaaagttattgtctgg
gacagggataatgagctttctgaagaggaatacggtagccattatataaactttcaaaaa
ttaatcaagtcaagcagccctgtttgtgacccagaagtcatggatgcggaagacccattg
tttattctttatacatcaggaacaacaggaaaaccaaagggtgttcttcatacaactggc
ggttatatggtaaacacgtatctaacaacaaaaacagtatttaatataaaagaagataca
atttattggtgtacagcagacattggatggattacaggccatagctatattgtctatgga
ccgcttgcgaacggtacaacgtcagtaataatggagggcgttccggtatatccacatcct
ggcatttggtgggagtacgttgaaaaatacagagtaaacgtattctatacagcacctaca
gccattagaatgcttatgagatttggagatgaaattccggcaaaatatgatttatcatcg
ttaaaaatacttggttctgttggtgagccaatcaatccagaagcttggatttggtattat
aaaaacatcggaaaagaaaaagctgctgtagttgacacatggtggcagacagaaacaggt
gcacacatgataacaacacttccatgttatcctgcaaagccgggtaaagcaggaaagcca
ttgtttggtgtggttccggcagtagttgataaagaaggtaatgagcttccacctaacaca
gtagggcatttagtgataaagaaaccatggccatctatgcttagaacatgttggggagag
ccggaaagatatgaaaaatactggaaagaaattcctggcggtgtttattcagcaggagac
cttgcttccgtagatgaagatggatatattatgattcttggacgtgctgatgacgtttta
agcgttgcaggacacagaataggtaatgcagaggttgaatctgcaatcgttgaacatcct
gcagttgcagaagcggctgtaattggaaagcctaacgaaattaaaggtgaatcgattaag
gcatttgtcatactaaaggaaggatattcaccatcacaagaattaataattgaaatcaaa
gaaacagttaaagatgtccttggtgctatagctgttccggacgaagtagaatttgttgat
aaactaccaaaaacaagaagtggtaaaataatgaggagagttttaagagccagagaatta
ggtcaagagcttggagacatatcaacacttgaagattag

DBGET integrated database retrieval system