KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_1703Help
Entry
SYO3AOP1_1703     CDS       T00715                                 

Definition
6-carboxyhexanoate--CoA ligase (EC:6.2.1.14)
Orthology
K01906  
6-carboxyhexanoate--CoA ligase [EC:6.2.1.14]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
Biotin metabolism
Metabolic pathways
Module
Biotin biosynthesis, BioW pathway, pimelate => pimeloyl-CoA => biotin
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SYO3AOP1_1703
Enzymes [BR:sul01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.14  6-carboxyhexanoate---CoA ligase
     SYO3AOP1_1703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1763558..1764295
Genome map
AA seq 245 aa AA seqDB search
MKFYSVKMRASLNDRHVSGGERITTEESIQKVVSELLTRPKEFDFVNIKIEKINNIKFIE
KSLDIKTINVKNHKEGNEIALKLLEEVGIDREIAKAYIDLLHTGANPDRENMRGAMIITR
SGKRVEKDRYRGVRTTNVDFLHREEVKKILLEKKYTERTLDALALSTKNLNHLDIIAEYC
ISDQPDYTTGYVAVNNTYYRINPLKEYSNPKGGRIYFVKDDTDIEELYKYLQEESFLIKE
VGSLE
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttatagtgtaaagatgagagcatcgcttaacgatagacatgtatcaggtgga
gaaagaataacaactgaagaaagcattcaaaaagtagtttcagagcttttgacaaggccc
aaagagtttgattttgtcaatataaaaatagaaaaaattaataatattaagtttatcgag
aaatctcttgatataaagacgatcaatgtaaaaaatcataaagaagggaatgaaattgca
ttaaaattacttgaagaggtcgggattgatagagaaattgctaaagcgtatatagattta
ttacatacaggagcaaatcctgatagagaaaacatgagaggagcaatgattataacaagg
tcaggcaaaagagtagaaaaagacagatacagaggagttagaactacaaacgtagatttt
ttacaccgtgaagaagtcaaaaaaatactgttagaaaaaaaatatacagaaagaacctta
gatgccttagcattatcaacaaaaaacctaaaccatctggatataatagctgaatactgt
atatcagaccaaccagactatacaaccggctacgttgcagttaataatacatattataga
atcaatccgttgaaagaatattcaaatccaaaaggtggtagaatatactttgtaaaagat
gataccgatattgaagagctttataaatatttacaggaagaaagctttttgattaaagag
gttggaagtttagaatga

DBGET integrated database retrieval system