KEGG   Uncultured Sulfuricurvum sp. RIFRC-1: B649_03970Help
Entry
B649_03970        CDS       T02537                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
sulr  Uncultured Sulfuricurvum sp. RIFRC-1
Brite
Enzymes [BR:sulr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     B649_03970
Secretion system [BR:sulr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   B649_03970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(778369..778863)
Genome map
AA seq 164 aa AA seqDB search
MYITKILSSAIHFMILLHGVFILQLHAAENTNKHQIALIQPIEQHAIIYGEGERKVYVFV
DPKCPHSRDFITMINENTKMRSMYRYYIFFYELKRFHSHHLIAAIYASSSPLQRTLEVMV
GAKVISTDLRNEPKIEAKIDDIASVANALGISKRPYLIILKENH
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgtacataactaaaattttatcatctgccattcattttatgattctactgcacggtgta
tttatcctacaactacatgcggccgagaatacgaacaaacatcaaattgccttaattcaa
cccatcgaacaacatgctatcatttatggagagggagaacgaaaagtatatgtatttgtc
gacccgaaatgtcctcattcgcgcgattttatcactatgattaatgagaatacaaaaatg
cgaagtatgtatcggtactatatctttttttatgaattaaaacgtttccattcgcatcat
ctaatagcagcgatatatgcgtcatcttcgcccctgcaacgaacactcgaagtgatggta
ggcgctaaagttatatcaacagatctccgaaatgaacccaaaattgaagcaaaaatagat
gatatagccagcgtcgctaatgccttaggtatttcaaaacgtccttatctgattatattg
aaagagaaccattag

DBGET integrated database retrieval system