KEGG   Uncultured Sulfuricurvum sp. RIFRC-1: B649_05395Help
Entry
B649_05395        CDS       T02537                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sulr  Uncultured Sulfuricurvum sp. RIFRC-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sulr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B649_05395
Enzymes [BR:sulr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     B649_05395
Exosome [BR:sulr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B649_05395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1071468..1073423
Genome map
AA seq 651 aa AA seqDB search
MYHTMSYEVSRLSEMDIYLFKQGTHSKLYNKLGSHAMEHKGKRGIYFAVWAPNAKYVSVR
GDFNDYSTDTHPLRLRQDDSGIWEGFIEGVEQGLTYKYQIVSKFHNIVHDKSDPFGFYAE
VPPKSASRVWSLENYEWYDNNWMKSRYKNNAHNAPISVYEVHLGSWRRHVEEGDRYLTYR
ELAVELVAYLNEMNYTHVEFMPLTEYPFFGSWGYQVVGYFAATARFGTPQDLMYLIDTLH
QNGVGVIMDWVPSHFAVDMHGLINFDGTALYEHDDPRQGYHPEWGSIIFNYGRNEVQSFL
ISSAMFWVDKYHIDGIRVDAVASMLYLNYARKEGEWIPNKYGGNENLEAIEFLKKLNTSV
YGAFPDILMIAEESTAYPMVTRPVDSGGLGFGFKWNMGWMHDSLKYMNYDPLYRQHHHHQ
LTFSMWYGFDENFMLPLSHDEVVHMKGSLINKMPGDTNQKFANLRSLYAYMMSHPGKKLL
FMGGEIAQYAEWNFERSLDWHLSDFPLHSGLQKMIAALNQLYRDERALHLYDEKREGFEW
IDDRDYSHNCLAYVRKSDNPADTIYVVCNFADATRENYKMGILESGEYVEIFNSQSTQYE
GWNIGNSTPIKSIHEEMHGRPFSLTLTLPPLGVIFLKQRETKPLVQLEKPV
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtatcatacaatgagctatgaggtttcacgtctgagtgaaatggatatttacctcttt
aagcaaggaacacactcaaagctctacaataaattgggttctcatgcgatggagcataaa
ggaaagagaggtatctatttcgctgtgtgggcacccaatgcgaagtatgtcagtgtacgg
ggcgattttaatgattacagcacggatactcaccctctgcgtttgcgtcaggatgattcg
ggaatttgggaaggttttattgaaggggtagaacagggtcttacctataaataccaaatc
gtatccaagtttcataatatcgtccacgataaaagtgatccgttcggattttatgccgaa
gtgcctccgaaatcggcatcgcgtgtctggagtttagagaactacgaatggtacgataac
aactggatgaaatcgcggtataagaataatgcgcataatgctccgattagcgtctatgaa
gttcatttgggttcatggcgaaggcacgtagaggagggggaccgttatctcacttaccgt
gaactggccgttgaactcgtagcgtatctcaatgagatgaactatacccatgttgagttt
atgccccttaccgaatatccgttttttggatcgtggggatatcaggtcgtcggatatttc
gccgctacggcacggtttggaacgccgcaggatttgatgtatttgattgatacgcttcat
caaaacggggttggtgttattatggactgggtaccgtctcattttgctgtcgatatgcac
ggactgatcaactttgatggaacggcactttatgaacatgatgatccgcgtcagggatac
cacccagaatggggaagcattatttttaactacggacgcaatgaggtccagtcgtttttg
atcagctctgcgatgttttgggtggataaatatcatatcgacggtatccgtgtggatgcg
gttgcttcgatgctttatctcaactacgcacgtaaagaaggtgaatggatccccaacaaa
tacggcggaaatgagaatttggaggcgatcgagtttttgaaaaaactcaataccagtgtc
tatggtgcattccctgacatactgatgattgctgaagaatcgaccgcttatccgatggta
acacgcccagtagattccggtggccttggatttgggtttaagtggaatatgggctggatg
cacgattcgctcaaatacatgaattacgatccgctgtaccgtcagcaccaccaccatcag
cttacctttagtatgtggtatggatttgacgagaattttatgttgccgctgagtcacgat
gaggtcgtccacatgaaaggttctctgattaataaaatgcccggagataccaatcagaaa
tttgcaaacctgcgctccttgtacgcttatatgatgtcacatccgggtaagaaactcctc
tttatggggggagaaattgcccaatacgccgaatggaattttgaacgctcacttgattgg
cacttgagcgattttcctctccattcgggtctgcaaaaaatgattgctgccctgaatcaa
ctctatcgcgatgagcgggctttacatctatatgatgagaaacgagaagggttcgagtgg
atcgatgatcgtgattacagccataactgcttggcatacgttcgaaaaagcgataatccg
gcggatactatctatgtcgtgtgcaactttgccgatgctacgagagaaaattataaaatg
ggcattttggagagcggagaatatgttgagattttcaactcccaatcaacgcagtatgag
ggatggaatatcggcaatagtactccgataaagagtattcacgaagagatgcacggacgt
ccgttttcacttactttaacgctccctccgctgggagtgatatttttaaaacaaagagaa
accaaacccttggtacaattagaaaaaccggtataa

DBGET integrated database retrieval system