KEGG   Uncultured Sulfuricurvum sp. RIFRC-1: B649_09895Help
Entry
B649_09895        CDS       T02537                                 

Definition
dtdp-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sulr  Uncultured Sulfuricurvum sp. RIFRC-1
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:sulr00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sulr00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1981160..1981732
Genome map
AA seq 190 aa AA seqDB search
MTFTRTAIPDVILIDPKVHGDARGYFVETFRADKLEAFLGFSAPFCQDNESKSSYGVLRG
LHYQLPPYAQTKLVRVIEGEVLDVAVDIRAGSPTFGQHVAIKLSGENKRQLFIPRGFAHG
FVVLSETCTFAYKVDNYYSPECDRGIAFNDPVLNIDWIVSTEKLQLSAKDTQQPLFADAD
HFTFGNDLYA
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgacctttacacgtaccgccatccctgatgttatcctcattgatcccaaagtgcatgga
gatgcacgtggttatttcgtcgaaaccttccgagccgataaactcgaagcatttttaggt
ttttcagcccctttctgccaagacaacgagtctaaatcgtcctatggagtattgcgtgga
ttgcactatcagcttcctccatacgcccaaactaaactggtacgggtcatcgagggagaa
gtgctcgatgtggcagtcgatattagagcaggttcacccacttttggtcagcatgtagcg
atcaaactctcaggcgaaaataaacgtcaactttttatccctcgaggattcgcgcatgga
tttgtggtgctctctgagacctgtacgtttgcctataaagtcgacaattactattctccc
gaatgtgatcgcggaatcgcttttaatgatccggtattaaacatcgattggatcgtttcg
acagaaaaacttcaactctcagccaaagatacccaacaaccattatttgctgatgcagac
catttcacttttggaaatgatttgtatgcctaa

DBGET integrated database retrieval system