KEGG   Uncultured Sulfuricurvum sp. RIFRC-1: B649_11700Help
Entry
B649_11700        CDS       T02537                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sulr  Uncultured Sulfuricurvum sp. RIFRC-1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sulr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2334250..2334837)
Genome map
AA seq 195 aa AA seqDB search
MSKENEQQNFEEAVKTMIRYVGEDVNREGLEKTPSRVLKAYEFMFGGYKEDPQTILNSAM
FASSNDEMVLVKDIEFYSTCEHHLLPIIGRAHVAYIPNGKVVGLSKIPRVVDVFARRMQI
QEQLTEQIADALMEAVEPKGVAVVIQARHMCMEMRGVEKICSTTTSSALRGLFKKDEKTR
MEFFSLINSSSGNRY
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaaaatgaacaacaaaactttgaagaagcggtcaaaacgatgattcgctat
gtcggtgaagacgttaatcgagaagggttggaaaaaactccaagccgtgttttgaaagcg
tatgaatttatgttcggcgggtacaaagaagatcctcaaaccattttaaattcggcgatg
ttcgcgagcagcaacgatgagatggttttagtcaaagatatcgagttttattcgacgtgc
gaacaccatcttcttccgattatcggacgggcccatgttgcttatatcccgaacggaaaa
gtggttgggctctccaagatccctcgtgttgtcgatgtctttgcgcgacggatgcagatt
caagagcagttgaccgagcagatcgccgatgcattgatggaagcggtagagcctaaaggg
gttgcggtggtgatccaagcgcgccatatgtgcatggagatgcgcggagtggaaaaaatc
tgctctacaacgacatcaagtgcgttacgaggattatttaaaaaagatgaaaagacccga
atggagtttttcagcttgatcaactcttccagcgggaaccgttactaa

DBGET integrated database retrieval system