KEGG   Candidatus Sulcia muelleri CARI: SMCARI_094Help
Entry
SMCARI_094        CDS       T01303                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sum  Candidatus Sulcia muelleri CARI
Pathway
sum00020  Citrate cycle (TCA cycle)
sum00640  Propanoate metabolism
sum00660  C5-Branched dibasic acid metabolism
sum01100  Metabolic pathways
sum01110  Biosynthesis of secondary metabolites
sum01120  Microbial metabolism in diverse environments
sum01130  Biosynthesis of antibiotics
sum01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sum00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SMCARI_094 (sucC)
   00640 Propanoate metabolism
    SMCARI_094 (sucC)
   00660 C5-Branched dibasic acid metabolism
    SMCARI_094 (sucC)
Enzymes [BR:sum01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SMCARI_094 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ADM89912
UniProt: E0TJD5
Position
97742..98920
Genome map
AA seq 392 aa AA seqDB search
MNIHEYQAQKILKTFGIKVPYSILASNLEETVYAAKKVFKKTKNYICVIKAQIHAGGRGK
GGGIKIAKSIDDVYKKSSNILGRRLVTNQTNKKGKLVNKVIISEYVLNSDKEYYVSIFYD
RNIYKNIILYSKEGGLEIEDISKKIYFQKIDPYIGLQEFQIRKIAFHLKMKYSAFNNFIK
KLYNAYIYSDASLFEINPFLITNDNEILAIDAKVRLDDNAFFRNLSYKEMSDEREYSIIE
LEAKKAGLNFLKLDGNVACMVNGAGLAMATMDMIKIYGANPANFLDLGGKADSKRIKKGL
DLILKDKKVKLILINIFGGIVRCDIVAEGIIKFFEKKNKINLPIIIRLEGTNVNIAKKIL
NNSKLHYYYVTSLEEAANKIKVLLKNELRCFI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacatgaatatcaagctcaaaaaatattaaaaacttttggtataaaagttcct
tatagtattcttgcttcaaatcttgaagaaactgtatatgctgctaaaaaagtatttaaa
aaaactaaaaattatatttgtgtaataaaagctcaaatccatgctgggggacgtggaaag
ggaggtggaataaaaatagcgaaatctatagatgacgtatataaaaaatcatcaaatatc
cttggtcgtagattagttactaatcaaacaaataaaaaaggtaaacttgtaaataaagta
ataatatcagaatatgttttaaattctgataaagaatattatgtatctatattttatgat
agaaatatatataaaaatataattctctattctaaagagggaggtctagaaatagaagat
atttctaaaaaaatttattttcaaaaaatagatccttatataggattacaagaatttcaa
attagaaaaatagcatttcatttaaaaatgaaatattcagcttttaataattttataaaa
aaattatataatgcttatatatattctgatgcttctctttttgagataaatcctttttta
ataactaatgataatgaaattttagcaatagatgctaaagttagattagatgataatgct
ttttttcgtaatctttcttataaagaaatgtctgatgaaagagaatattctattatagaa
ttagaagctaaaaaagcaggtttaaattttctaaagttagatgggaatgtagcctgtatg
gtaaatggagcgggtttagctatggctactatggatatgataaaaatatatggagctaat
ccagctaattttttagatttaggtggtaaagctgattcaaaacgaataaaaaaaggattg
gatttaatcttaaaagataaaaaagttaaattaatattaataaatatttttggaggaatt
gttcggtgtgatatagttgctgaaggcattataaaattttttgaaaaaaaaaataaaatt
aatttaccaataattataaggttagaaggtacaaatgtaaatatagcaaaaaaaatccta
aataatagtaaattacattattattatgtaacttctcttgaagaagctgctaataaaata
aaagttttattaaaaaatgaattacgttgtttcatatag

DBGET integrated database retrieval system