KEGG   Candidatus Sulcia muelleri CARI: SMCARI_154Help
Entry
SMCARI_154        CDS       T01303                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sum  Candidatus Sulcia muelleri CARI
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sum00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMCARI_154 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMCARI_154 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SMCARI_154 (thrC)
Enzymes [BR:sum01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SMCARI_154 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(163496..164800)
Genome map
AA seq 434 aa AA seqDB search
MLYKSLKNYKYKVSFKEAVLTGQSPEKGLYFPEKIPLLEKKIIKNISNYDVNDLIMEVIQ
PFIGNEIPYKELLNIISNTLNFKININNIYNNIFSLELFLGPTMAFKDIGVKFLSGCIKY
FRKNFNKNIIILTATSGDTGAAVAHAFNKIDGVKVVILYPSSKISILQEKQITTLGDNII
ALEIKGNFDDCQILVKQAFSDEQIREKLFLTSANSINIARLLSQIFYYFMCYKLLHSNKK
LVFSIPSGNYGNICAGLIAFKMGLPIKHFIAATNINDTIPRLLKTGIYNPYPSQETISNA
MDISDPSNFSRIMYMFKTINNLKKIVSAYTFTDKETIDIIKYIWNNYKYMMDPHGAIGFL
GLIKFIKNYKNNNFHNIFLSTAAPVKFLDKITEDLSDKIFLDKKVIKLIKKNKKSIHLSN
KYEIFQNWLLSNNI
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgctgtataaaagtttaaaaaattataaatataaagtttcttttaaggaagcggtttta
actggacaaagtccagaaaaaggtttgtattttcctgaaaaaatacctttattagaaaaa
aaaattattaaaaatatatcaaattatgatgtaaacgatttaattatggaagtaatacaa
ccattcattggaaatgaaattccatataaagaattattaaatattatatctaatacatta
aattttaaaataaatataaataatatttataataatattttttcattagagttattttta
ggacctactatggcttttaaagatataggagtaaaatttttgtcaggatgtataaaatat
tttaggaaaaattttaataaaaatattataatacttactgctacttctggggatacagga
gctgcggtagctcatgcttttaataaaattgatggtgtaaaagtagtaatattatatcct
tcttctaaaataagtattttacaagaaaaacagataacaacattaggagataatattata
gctttagaaataaaaggaaattttgatgattgccaaattttggtaaaacaagctttttcc
gacgaacaaatacgtgaaaaattatttttaacatcagcaaattctataaatattgcacgt
ttactttctcaaatattttattattttatgtgttataaactattacattccaataagaaa
ctggttttttctattcctagtggaaattatggaaatatatgtgcaggattaatagcattt
aaaatggggttacctataaaacattttattgcagctacaaatataaatgacacaattcct
agattattaaaaacaggaatttataacccatatccttcacaagaaacaatttctaatgct
atggatatatctgatccaagtaattttagtcgtataatgtatatgtttaaaacaataaat
aacctaaaaaaaattgtatctgcatatacttttactgataaagaaacaattgatattatt
aaatatatttggaataattataaatatatgatggatccacatggagcaattggattttta
ggtttaattaaatttattaaaaattataaaaataataattttcataatatttttttatca
acagccgctccagttaaatttttagataaaattactgaggatttatctgataaaatcttt
ttagataaaaaagtaataaaacttataaaaaaaaataaaaaaagtatacacttaagtaat
aagtatgaaatttttcaaaattggttattaagtaataatatataa

DBGET integrated database retrieval system