KEGG   Candidatus Sulcia muelleri CARI: SMCARI_154Help
Entry
SMCARI_154        CDS       T01303                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sum  Candidatus Sulcia muelleri CARI
Pathway
sum00260  Glycine, serine and threonine metabolism
sum01100  Metabolic pathways
sum01110  Biosynthesis of secondary metabolites
sum01120  Microbial metabolism in diverse environments
sum01230  Biosynthesis of amino acids
Module
sum_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sum00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMCARI_154 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SMCARI_154 (thrC)
Enzymes [BR:sum01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SMCARI_154 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ADM89966
UniProt: E0TJI9
Position
complement(163496..164800)
Genome map
AA seq 434 aa AA seqDB search
MLYKSLKNYKYKVSFKEAVLTGQSPEKGLYFPEKIPLLEKKIIKNISNYDVNDLIMEVIQ
PFIGNEIPYKELLNIISNTLNFKININNIYNNIFSLELFLGPTMAFKDIGVKFLSGCIKY
FRKNFNKNIIILTATSGDTGAAVAHAFNKIDGVKVVILYPSSKISILQEKQITTLGDNII
ALEIKGNFDDCQILVKQAFSDEQIREKLFLTSANSINIARLLSQIFYYFMCYKLLHSNKK
LVFSIPSGNYGNICAGLIAFKMGLPIKHFIAATNINDTIPRLLKTGIYNPYPSQETISNA
MDISDPSNFSRIMYMFKTINNLKKIVSAYTFTDKETIDIIKYIWNNYKYMMDPHGAIGFL
GLIKFIKNYKNNNFHNIFLSTAAPVKFLDKITEDLSDKIFLDKKVIKLIKKNKKSIHLSN
KYEIFQNWLLSNNI
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgctgtataaaagtttaaaaaattataaatataaagtttcttttaaggaagcggtttta
actggacaaagtccagaaaaaggtttgtattttcctgaaaaaatacctttattagaaaaa
aaaattattaaaaatatatcaaattatgatgtaaacgatttaattatggaagtaatacaa
ccattcattggaaatgaaattccatataaagaattattaaatattatatctaatacatta
aattttaaaataaatataaataatatttataataatattttttcattagagttattttta
ggacctactatggcttttaaagatataggagtaaaatttttgtcaggatgtataaaatat
tttaggaaaaattttaataaaaatattataatacttactgctacttctggggatacagga
gctgcggtagctcatgcttttaataaaattgatggtgtaaaagtagtaatattatatcct
tcttctaaaataagtattttacaagaaaaacagataacaacattaggagataatattata
gctttagaaataaaaggaaattttgatgattgccaaattttggtaaaacaagctttttcc
gacgaacaaatacgtgaaaaattatttttaacatcagcaaattctataaatattgcacgt
ttactttctcaaatattttattattttatgtgttataaactattacattccaataagaaa
ctggttttttctattcctagtggaaattatggaaatatatgtgcaggattaatagcattt
aaaatggggttacctataaaacattttattgcagctacaaatataaatgacacaattcct
agattattaaaaacaggaatttataacccatatccttcacaagaaacaatttctaatgct
atggatatatctgatccaagtaattttagtcgtataatgtatatgtttaaaacaataaat
aacctaaaaaaaattgtatctgcatatacttttactgataaagaaacaattgatattatt
aaatatatttggaataattataaatatatgatggatccacatggagcaattggattttta
ggtttaattaaatttattaaaaattataaaaataataattttcataatatttttttatca
acagccgctccagttaaatttttagataaaattactgaggatttatctgataaaatcttt
ttagataaaaaagtaataaaacttataaaaaaaaataaaaaaagtatacacttaagtaat
aagtatgaaatttttcaaaattggttattaagtaataatatataa

DBGET integrated database retrieval system