KEGG   Candidatus Sulcia muelleri CARI: SMCARI_204Help
Entry
SMCARI_204        CDS       T01303                                 

Gene name
sucB
Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 component
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sum  Candidatus Sulcia muelleri CARI
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sum00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMCARI_204 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SMCARI_204 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SMCARI_204 (sucB)
Enzymes [BR:sum01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SMCARI_204 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
209762..210877
Genome map
AA seq 371 aa AA seqDB search
MILEIKVPSPGESITEVEISSWLFKNGDFVKKNQVIAEIDSDKATLEICAEESGMLIIKA
KKGDILKVGEILCLIDTSFSKEKRNFIAPSTIKRLNQYKIDKKKIISKNKKYDAIKKIPS
MGTKNLINRSFDITKLSKLRRKLSERLVSVKNETAMLTTFNEVDMSNIFFLRKKYKNVFK
EKHGVKLGLMSFFVKSCIIALKKYPDINSMIDGENKINFKYYDISIAVSGPKGLMVPVIR
NADTLSFRGIENTIKNLSNSIKNSTISIDDLTGGTFTITNGGIFGSMLSTPIINPPQSAI
LGMHNIVERPIVKLGKLEIRPIMYLALSYDHRIIDGKEAVGFLLSIKESIENPIKNLIGS
EENLKNSFELK
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgatattagaaataaaagttccttctccaggagaatcaataacagaagttgaaatatca
tcttggttatttaaaaatggtgattttgttaaaaaaaatcaagttattgcagaaatagat
tcagataaggctactttagaaatctgtgcagaagaaagtggaatgttaattataaaagct
aaaaaaggagatattttaaaagtaggagaaatattatgtttaatagatacttctttttca
aaagaaaaaagaaattttattgctccatcaacaataaaaagattaaatcaatataaaatt
gataaaaaaaaaattatttcaaaaaataaaaaatatgatgctattaaaaaaattccatct
atgggaactaaaaatttaattaatagatcttttgacataacaaagttatctaaacttaga
cgtaaattatcagaaagacttgtttccgtaaaaaatgaaacagctatgcttactactttt
aacgaagtagatatgagtaatatcttttttttaagaaaaaaatataaaaatgtttttaaa
gaaaaacatggagttaaattaggattaatgtctttttttgtcaaatcttgtataatagcg
ttaaaaaaatatccagatattaattctatgatagatggggaaaataaaataaattttaaa
tattatgatataagtattgcagtatctggaccaaaaggtttgatggtcccagttattaga
aatgctgatactctttcttttagaggaatagaaaatactataaaaaatttatctaatagt
ataaaaaattcaactatatctatagatgatcttactggaggtacttttactataacaaat
ggaggcatttttggatctatgttatctactcctataataaatcctccccaaagtgctata
ttaggtatgcataatatagtagaaagacctatagtaaaattaggaaaactagaaattaga
ccaattatgtatttagcattatcttatgatcatcgtataatagatggaaaagaagcagtg
ggatttttattatcaataaaagaatcaatagaaaatcctattaaaaatttaataggatca
gaagaaaatttaaaaaattcttttgaattaaaataa

DBGET integrated database retrieval system