KEGG   Candidatus Sulcia muelleri CARI: SMCARI_276Help
Entry
SMCARI_276        CDS       T01303                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoamide acyltransferase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sum  Candidatus Sulcia muelleri CARI
Pathway
sum00010  Glycolysis / Gluconeogenesis
sum00020  Citrate cycle (TCA cycle)
sum00620  Pyruvate metabolism
sum01100  Metabolic pathways
sum01110  Biosynthesis of secondary metabolites
sum01120  Microbial metabolism in diverse environments
sum01130  Biosynthesis of antibiotics
sum01200  Carbon metabolism
Module
sum_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sum00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMCARI_276 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SMCARI_276 (pdhC)
   00620 Pyruvate metabolism
    SMCARI_276 (pdhC)
Enzymes [BR:sum01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SMCARI_276 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF2118 Troponin DUF3915
Motif
Other DBs
NCBI-ProteinID: ADM90070
UniProt: E0TJU3
Position
263351..264508
Genome map
AA seq 385 aa AA seqDB search
MAEVILMPRLSDTMEEGTVVKWHKNIGDKILEGDILAEIETDKAIQEFEAESNSTLLYIG
IKEGESAPVNSLLAILGSEHEDISSLLKEINEKEKEINEKEKEINEKEKEINEKRIFVSP
LAKKIAFDKGISLEKIKGTVNNGRIIKKDIEKYYKKKKLNSNEVDHSHMRKIISKRLINS
KIESPHYSLFIEIIMDNLIKLRNSINEKKNLNKISFNDLIVKASAIAIKENPKINSSWTE
KSILYHNNINIGIAVALEDGLIVPVINNVEKKSLRQISFEIKEKVIKAKKNKIQSNDLEG
STFTVSNLGMFGIDSFTSIINQPNSCILSVGSIKKKPIINNDKIVIGNTTKFTLTCDHRM
IDGAVGSDYLKSLKNLLQKPLNILI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagttatattgatgcctcgtttaagcgatactatggaagaaggtactgttgta
aaatggcataaaaatataggtgataaaattttagaaggagatattttagctgaaatagaa
actgataaagcaattcaggaatttgaagctgaatctaattctacattactttatattgga
attaaagaaggagaaagtgccccagtaaatagtttattagctattttaggttctgaacat
gaagatattagttctttgctaaaagaaataaatgaaaaagaaaaagaaataaatgaaaaa
gaaaaagaaataaatgaaaaagaaaaagaaataaatgaaaaaagaatttttgtttctcct
ttagctaaaaaaattgcttttgataaaggaatctcattagagaagattaaaggcactgta
aataatggacgtattataaaaaaagatatagaaaaatattataaaaaaaagaaattaaat
tctaatgaagttgatcattctcatatgagaaaaataattagtaaaagattaattaattct
aaaattgaatcacctcattattctttatttatagaaataattatggataatttaattaaa
ttaagaaactctattaatgaaaaaaaaaatttaaataaaatatcttttaatgatttaatt
gtgaaagcttcagctatagctataaaagaaaatcctaaaataaattcttcttggacagaa
aaaagtatattataccataataatattaatataggtatagcagtagcattagaagatgga
ttaattgttcctgtaattaataatgtagagaaaaaatctttaagacaaatctcttttgag
ataaaagaaaaagtaataaaagctaaaaaaaataaaatacaatctaatgatttagaaggt
agtacttttactgtttcaaatcttggaatgtttggtatagattcatttacatctattata
aatcaacctaattcttgtattttatctgtaggaagtataaaaaaaaaacctattataaat
aatgataaaattgtaataggtaatactactaaattcacattaacatgtgatcatagaatg
atagatggtgcagtaggtagtgattatttaaaaagtttaaaaaacttattacaaaagcca
ttaaatatattaatttaa

DBGET integrated database retrieval system