KEGG   Candidatus Sulcia muelleri CARI: SMCARI_278Help
Entry
SMCARI_278        CDS       T01303                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sum  Candidatus Sulcia muelleri CARI
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:sum01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sum01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sum00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sum00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sum00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism
Metabolism; Energy metabolism; Methane metabolism [PATH:sum00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
265301..266278
Genome map
AA seq 325 aa AA seqDB search
MNIGKIGILTSGGDSPGMNAAIRAVVRTASYYCVNCIGISLGYKGLINNEMRKVVPTDVN
NLIHRGGTILKTARSEEFKTKFGRKKANINYKKNGLEGLIVIGGDGSFTGAMIFGQEYNI
PIIGIPGTIDNDIYGTDFTVGYDTALNTAIEAIDKIRDTATSHNRLFFIEVMGKDSGFIA
LNSGIATGALDILIPEKKYNLDKLFYSIEKVKQKGKYSSIIIVSEGKKLGGVYDLAKTTK
KKFPDYDIRVSILGHIQRGGYPTCSDRVLASRLGVASVEALISGKKNVMTGIKANKVIFT
PFLKAIKKKRKIDIDLIKISDIIAC
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaatataggtaaaatcggtattttgacctcaggaggagattctcctggtatgaatgct
gcaattcgtgctgttgttagaacagcttcatattattgtgtgaattgtattggtatatca
ttaggatataaaggtttaattaataatgaaatgagaaaggtagtacctacagatgtaaat
aatctaattcatagagggggaactatattaaaaactgctcgttctgaggaatttaaaacc
aaatttggtagaaaaaaagcaaatataaattataaaaaaaatggattagaaggacttata
gtaattggtggcgatggatcatttactggagctatgatttttggtcaagaatataatatt
cctattataggaattccaggtactattgataatgatatatatggaactgattttactgtt
ggatatgatactgcattaaatacagcaatagaagctatagataaaattagagatacagct
acatctcataatagattattttttatagaagttatgggaaaagattccggttttatagcg
ttaaatagtggtattgctactggagctttagatatacttattccagaaaaaaaatataat
ttagataaacttttttattcaatagaaaaagtaaaacaaaaaggtaaatattctagtata
attattgtttctgaaggaaaaaaattaggaggtgtttatgatttagctaaaactacaaaa
aaaaaatttcctgattatgatatacgtgtttctatattaggtcatatccaaagaggaggt
tatcctacttgttcagatcgtgttcttgcaagccgtcttggagtagcttctgttgaagct
ttaatttcaggtaaaaaaaacgtaatgacaggaataaaagctaataaagtaatatttact
ccctttttaaaagctataaaaaaaaaaagaaaaattgatatagatcttattaagatatca
gatattatagcttgttaa

DBGET integrated database retrieval system