KEGG   Candidatus Sulcia muelleri CARI: SMCARI_278Help
Entry
SMCARI_278        CDS       T01303                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sum  Candidatus Sulcia muelleri CARI
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sum00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMCARI_278 (pfkA)
   01230 Biosynthesis of amino acids
    SMCARI_278 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMCARI_278 (pfkA)
   00030 Pentose phosphate pathway
    SMCARI_278 (pfkA)
   00051 Fructose and mannose metabolism
    SMCARI_278 (pfkA)
   00052 Galactose metabolism
    SMCARI_278 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SMCARI_278 (pfkA)
Enzymes [BR:sum01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SMCARI_278 (pfkA)
Protein phosphatases and associated proteins [BR:sum01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SMCARI_278 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
265301..266278
Genome map
AA seq 325 aa AA seqDB search
MNIGKIGILTSGGDSPGMNAAIRAVVRTASYYCVNCIGISLGYKGLINNEMRKVVPTDVN
NLIHRGGTILKTARSEEFKTKFGRKKANINYKKNGLEGLIVIGGDGSFTGAMIFGQEYNI
PIIGIPGTIDNDIYGTDFTVGYDTALNTAIEAIDKIRDTATSHNRLFFIEVMGKDSGFIA
LNSGIATGALDILIPEKKYNLDKLFYSIEKVKQKGKYSSIIIVSEGKKLGGVYDLAKTTK
KKFPDYDIRVSILGHIQRGGYPTCSDRVLASRLGVASVEALISGKKNVMTGIKANKVIFT
PFLKAIKKKRKIDIDLIKISDIIAC
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaatataggtaaaatcggtattttgacctcaggaggagattctcctggtatgaatgct
gcaattcgtgctgttgttagaacagcttcatattattgtgtgaattgtattggtatatca
ttaggatataaaggtttaattaataatgaaatgagaaaggtagtacctacagatgtaaat
aatctaattcatagagggggaactatattaaaaactgctcgttctgaggaatttaaaacc
aaatttggtagaaaaaaagcaaatataaattataaaaaaaatggattagaaggacttata
gtaattggtggcgatggatcatttactggagctatgatttttggtcaagaatataatatt
cctattataggaattccaggtactattgataatgatatatatggaactgattttactgtt
ggatatgatactgcattaaatacagcaatagaagctatagataaaattagagatacagct
acatctcataatagattattttttatagaagttatgggaaaagattccggttttatagcg
ttaaatagtggtattgctactggagctttagatatacttattccagaaaaaaaatataat
ttagataaacttttttattcaatagaaaaagtaaaacaaaaaggtaaatattctagtata
attattgtttctgaaggaaaaaaattaggaggtgtttatgatttagctaaaactacaaaa
aaaaaatttcctgattatgatatacgtgtttctatattaggtcatatccaaagaggaggt
tatcctacttgttcagatcgtgttcttgcaagccgtcttggagtagcttctgttgaagct
ttaatttcaggtaaaaaaaacgtaatgacaggaataaaagctaataaagtaatatttact
ccctttttaaaagctataaaaaaaaaaagaaaaattgatatagatcttattaagatatca
gatattatagcttgttaa

DBGET integrated database retrieval system