KEGG   Sulfurovum sp. NBC37-1: SUN_0199Help
Entry
SUN_0199          CDS       T00572                                 

Gene name
porD
Definition
(GenBank) pyruvate:ferredoxin oxidoreductase, delta subunit
  KO
K00171  
pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SUN_0199 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUN_0199 (porD)
   00020 Citrate cycle (TCA cycle)
    SUN_0199 (porD)
   00620 Pyruvate metabolism
    SUN_0199 (porD)
   00640 Propanoate metabolism
    SUN_0199 (porD)
   00650 Butanoate metabolism
    SUN_0199 (porD)
  Energy metabolism
   00680 Methane metabolism
    SUN_0199 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SUN_0199 (porD)
Enzymes [BR:sun01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SUN_0199 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
204147..204602
Genome map
AA seq 151 aa AA seqDB search
MQDLHLCAAEKRGIHQLGGDERVGWDEVTQGIILTSFEGDASEIVHQKAEQRHYSDFNSY
TASVASWRVEKPVFNIDVCIDCQNCWVWCPDTSIISRDKQMLGIDYDHCKGCGVCVEVCP
TNPKSLLMFNEQSGLDEALAAWPEKKKKEEK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatttacatttatgtgcagcagaaaaaagaggaattcatcagcttggcggtgat
gagcgtgtaggatgggatgaagtgacacagggtatcatacttacttcttttgaaggagat
gcctcagaaattgttcaccaaaaagcggaacagagacattattcggatttcaactcctat
acggcatcggtggcttcctggagagtggaaaagccggtatttaacatcgatgtatgtatc
gattgtcaaaactgttgggtatggtgcccggatacatctattatctctagagacaagcag
atgctggggatcgattatgaccactgtaaaggatgcggggtatgtgttgaagtatgtccg
acaaacccgaaatcgcttttaatgttcaatgagcagtctggattggatgaagcacttgct
gcatggccagagaaaaagaaaaaagaagagaagtaa

DBGET integrated database retrieval system