KEGG   Sulfurovum sp. NBC37-1: SUN_0200Help
Entry
SUN_0200          CDS       T00572                                 

Gene name
porA
Definition
pyruvate flavodoxin oxidoreductase subunit alpha (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:sun01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sun00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sun00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sun00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sun00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sun00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:sun00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:sun00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
204612..205844
Genome map
AA seq 410 aa AA seqDB search
MAEKFDLNDREVWDGNYAASQALRQAQIDVVAAYPITPSTPIVENYGAYVANGYVDGEYV
MVESEHAAMSGCVGASAAGGRVATATSSQGFALMVEVLYQASGMRLPIVLNVVNRALASP
LNVRGDHGDMYLGRDSGWIQIDAFNAQEAYDLVLCAFKIGEDHSVRLPVMVHQDGFITSH
TAQNIYPLTDEAAYNFIGDFQPVDDLLDFSRPVTYGAQTEEDWHFEHKAKQHKALMDSRP
VIDEVFAEFEKLSGRKYNRVETYMMEDADVVIVGLGSTVETAIVAAEELREEGVKAGVVG
IRVFRPFPFDQVREALKGAKAIAVLDRSSPGGAMGAFFNEVSAALYSTDTRPLVTNYIYG
LGGRDFSIDEAKRIFKEQQANADAGHITTDIQQFSGLRGPHLGYFQTQRG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaatttgatttaaatgacagagaagtctgggacggtaactatgctgcttcc
caggcactgagacaggcacagattgatgttgttgcggcgtatcctattacgccttcaacc
cctattgttgaaaattatggagcctatgtagcgaacggatatgttgacggtgaatatgta
atggtcgagtctgaacatgcagctatgtccggatgtgtaggtgcttctgcagcaggcgga
cgtgtcgctacggctacttcttctcagggattcgcccttatggtcgaggtactataccag
gcatccggcatgagactccctatcgtactaaacgtggtaaacagagcattggcttcgccg
ttgaatgtacgtggtgaccatggcgacatgtatcttggtagagattccggttggatccag
atagatgcattcaatgcacaggaagcttatgacttggtattatgtgcatttaagattggt
gaggaccactcggtaagactgccggtcatggtacatcaggacggattcatcacttcgcat
acggctcagaatatctatccgttgacagatgaggcggcatataacttcatcggtgatttt
cagccggttgatgatcttcttgatttctccagacctgtgacgtacggtgcacagacggaa
gaagactggcactttgagcataaagcgaagcagcataaagcgctgatggattcacgcccg
gttatcgatgaggtttttgccgaatttgagaaactcagcggaagaaaatacaacagggtt
gaaacctatatgatggaagatgccgatgttgttatcgtgggactaggtagtacggttgag
acggcaattgtggcagcggaagagttgagagaagaaggtgtcaaagcgggtgtagttggg
atcagagtattcagaccgttcccgttcgatcaggtaagagaagcacttaaaggtgccaag
gcgatcgccgttctggacaggtcaagcccaggcggtgcgatgggggccttcttcaacgaa
gtgtccgcagcactctattcaacagatacgagaccgcttgtaacgaactatatctacggt
cttggcggacgtgatttttccatcgatgaagcaaaaagaatatttaaagagcagcaggca
aatgcagatgctggacatattacaacagatatccaacagttctcaggacttagaggtcca
caccttggatacttccaaacacaaagaggttaa

DBGET integrated database retrieval system