KEGG   Sulfurovum sp. NBC37-1: SUN_0201Help
Entry
SUN_0201          CDS       T00572                                 

Gene name
porB
Definition
(GenBank) pyruvate:ferredoxin oxidoreductase, beta subunit (EC:1.2.7.1)
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SUN_0201 (porB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUN_0201 (porB)
   00020 Citrate cycle (TCA cycle)
    SUN_0201 (porB)
   00620 Pyruvate metabolism
    SUN_0201 (porB)
   00640 Propanoate metabolism
    SUN_0201 (porB)
   00650 Butanoate metabolism
    SUN_0201 (porB)
  Energy metabolism
   00680 Methane metabolism
    SUN_0201 (porB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SUN_0201 (porB)
Enzymes [BR:sun01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SUN_0201 (porB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
205847..206800
Genome map
AA seq 317 aa AA seqDB search
MAITSIKNLKEFSTNNDRFEGAHTLCPGCAHSMIVRELMNCTDDNLVISSNTGCLEVSTA
VYPFTSWDTSWIHIGFENAATAVTGAEAMYKARKKKGTLKDNDAPVKFVAFGGDGSTYDI
GFQWLSGAVERGHDFTYICLDNENYANTGGQRSSATPIGATTSTAQAGTHSYGKKEKKKD
LVAIMAAHGAPYVAQLAPNKWKSMAKGFQKALETEGPCFINTVSPCTTEWKFDPKDTILL
TDLATDTLMFPLYEIIDGHELNILYRPKNVLKVEDYLGAQGRYKHLFKPENKHVIEKIQK
DIDEYWTMLQRREEARI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggctattacatcaattaagaacttaaaagaattttcgacaaataatgacagatttgag
ggtgcacataccctgtgtccgggatgtgcccactctatgatcgtcagagaacttatgaat
tgtacagatgacaaccttgtcatctcttccaatacaggatgcctggaagtatctacagcg
gtttatccgttcacttcatgggatacctcgtggatacacatcgggtttgagaatgctgca
accgcggtaaccggtgcggaagcaatgtataaagcaagaaagaaaaaaggtacgctcaag
gacaatgacgctccggtaaagtttgtcgcttttggtggtgacggttctacatacgatatc
ggtttccagtggctttcaggtgcggtagaaagaggtcatgactttacgtacatctgtctt
gacaatgagaactatgccaacacgggtggtcaaagatcgtcagcaacacctattggtgct
acaacatctacagcacaggcaggaacacattcttacggtaagaaagagaagaaaaaagat
cttgtcgctattatggctgcacatggtgcgccatatgttgcacaattggctccgaacaag
tggaagtctatggcaaaaggtttccagaaagcacttgaaacagaagggccttgtttcatc
aacacggtctctccatgtacaacagaatggaaattcgatccaaaagatacgattctcctg
actgacctggcaacagatacattgatgttcccgctctatgaaattattgacggccatgaa
cttaacattctttatagacctaaaaatgtactgaaagtagaagattaccttggggctcag
ggacgttacaaacatctcttcaagcctgagaacaaacatgtgatcgagaaaatacagaaa
gatattgatgagtattggacaatgctacagcgccgcgaagaagcgcgcatataa

DBGET integrated database retrieval system