KEGG   Sulfurovum sp. NBC37-1: SUN_0381Help
Entry
SUN_0381          CDS       T00572                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun00900  Terpenoid backbone biosynthesis
sun01100  Metabolic pathways
sun01110  Biosynthesis of secondary metabolites
sun01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SUN_0381
Enzymes [BR:sun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SUN_0381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: BAF71341
UniProt: A6Q782
Position
complement(388927..389694)
Genome map
AA seq 255 aa AA seqDB search
MYSINAHAKVNIFLKITGHENGYHTLLSRFMRVDDLYDTITLVPGTFDSFTLEGCKGVPL
HFNTIYKAYEALLEPFPKLEDFFKSHKVVVEKSIPSQAGLGGGSSDAGAFMRLINSLSQN
PLSTDALAKLGSSIGADVPFFVYNYPSANVRGFGEIVEPFRETPLKLELFTPDIGCDTAK
VYQTYHKYLLRTLDPKSFFGWENMDSGTLLQLIADPVALNDLYPAALSTCPALEKLDTKG
WFFSGSGSTFFRVKD
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtacagcatcaatgcccacgcaaaagttaacattttcctcaaaattaccggccatgag
aacggctatcataccctgctctcccgcttcatgcgcgtggatgacctttacgataccatc
actcttgttcccggaacatttgacagttttacactggaaggatgtaaaggggtgcctcta
catttcaatacgatatacaaagcgtatgaagcactgctcgaacccttcccgaaacttgaa
gatttcttcaagtcgcataaagtcgtggtggaaaaatccatcccctcacaggcggggctt
ggcggaggcagctctgatgcaggggcgttcatgcgtcttataaattcgctttcacagaat
cctctcagtaccgatgcactggctaaactgggcagcagcatcggggcggatgttcccttt
tttgtctacaactatcccagtgccaatgtacgcggttttggagagatcgtcgagccattc
agggaaacacccctcaaactggagctttttacacccgatatcggatgtgacacagccaaa
gtctaccaaacctaccacaagtacctcttgcgaactttggacccaaaatccttcttcgga
tgggaaaacatggattcaggaacactcctacagctcattgcagaccccgtcgccctcaat
gacctctatcctgcagcactttccacctgccccgcactggaaaaactcgataccaaaggg
tggttcttcagcggtagcggcagtacgttctttcgagtgaaggattag

DBGET integrated database retrieval system