KEGG   Sulfurovum sp. NBC37-1: SUN_0447Help
Entry
SUN_0447          CDS       T00572                                 

Definition
glycosyl hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SUN_0447
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SUN_0447
Enzymes [BR:sun01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SUN_0447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
453670..454755
Genome map
AA seq 361 aa AA seqDB search
MKKIFLMVAVMAVTSLWAGVSLDQKIGQMLMVGFHGTSAPKNSRICQDIRKYHIGAVILF
DYNPVDKSKPKNIASRKQLKKLTAQLQKCSYDGKLLIAVDQEGGKVQRLKRKYGFYGNFP
KASDVTRMDKKQIKKTYRKMAKELKSVGINYDLAPVVDLDINPKNHVIHGLGRSFGKDPK
TVAAYASTFIDAMHHYGVLTSLKHFPGHGSSVGDTHKGFVDVTNLWKRVELEPYRLLNRK
ADTVMVAHVFNKKLDARYPASFSNRTVNGILRKQLGFNGVVITDDLQMGAISKKYGLKNT
LKLAINAGDDILLFGNQLDPRKTVSTKKLVETIKSLLKRGEVNPKSIDYAYIRIQNLKRK
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatatttttaatggtcgcagttatggctgtaacatcactttgggccggggtt
tccctcgatcagaagataggacagatgcttatggttggctttcacggaacttctgcaccc
aagaacagccggatctgtcaggatatccgaaaatatcacatcggtgcggtcatactgttt
gactacaatcctgtcgacaaaagtaaacccaaaaatattgcaagcagaaaacagttgaaa
aaactgacggcacaactgcagaaatgttcctatgacggaaagctcctgatcgccgtggac
caggaagggggaaaggtacagcgtctcaaaagaaagtacggattttatgggaattttcct
aaagcttccgatgttaccaggatggacaagaaacagataaaaaaaacatatagaaaaatg
gctaaagaacttaaatctgtggggatcaactatgatctcgccccggtggtcgacctggat
attaacccgaagaaccatgtgatccacgggctcggacgttctttcgggaaagacccaaaa
acagttgcggcttatgcaagtaccttcatcgatgcaatgcaccattacggtgtattgacc
tcactgaaacatttccccggacacggctcttctgtaggcgatacgcacaaagggttcgtg
gatgtcacgaatctttggaagcgtgtggagctcgaaccctacaggcttttgaacagaaaa
gccgacacagtcatggtcgcgcatgtcttcaacaaaaaactcgacgccagatatccggca
agcttttcgaacagaacggtgaatggaatactgcgcaaacaactcggttttaacggtgtg
gtgattacggatgatctgcagatgggagccatcagcaaaaaatacggtttgaaaaatacg
cttaaactggcgatcaacgcaggagacgacatactgctttttggtaatcagctcgatccg
cgaaaaacggtcagtaccaaaaagcttgttgaaacgatcaagtcgctactgaagcgcggc
gaggtgaatccaaagagtatcgactatgcctatatacgcatccagaatttgaagcgaaaa
ctgtaa

DBGET integrated database retrieval system