KEGG   Sulfurovum sp. NBC37-1: SUN_0489Help
Entry
SUN_0489          CDS       T00572                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sun01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sun00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
496085..497188
Genome map
AA seq 367 aa AA seqDB search
MNVVDLLMKLLSFKSVTPDDAGSLAFIESYLKGYEATYVNKEGVKNLFLTKKFSEGPHLC
FAGHVDVVPAGDGWHTNPFVPVIKEGKIYARGTQDMKSGVAAFVQAVKECEDFSGRLSIL
LTSDEEGDATYGTQIMLQHLKEIDLLPDACIVAEPTCETAFGDAIKVGRRGSVNGVIEKH
GIQGHAAYPEKAKNPIHKVAQVLPMMAGVNLDEGDEFFGPSQFVITDLRAGMEVTNVTPG
KLKMMFNVRNSTETTLEDVEKFVHTYFNGMDYDLTLKQSATPFLTDPDRPIVHALDESIQ
KVCGITPKHSTAGGTSDARFIAADNIDVIEFGVINDTIHAPNERTSIEEVEKLYEVFKET
IKYFTQG
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcgtcgaccttttaatgaagctgttgagcttcaaatccgttacacccgatgat
gcaggttccctggcattcatagaatcttatcttaaagggtacgaagcaacatatgtgaac
aaagagggagtaaagaatctctttttgaccaaaaaattctccgagggaccccatctctgc
tttgccggtcatgtcgatgtcgttcctgccggtgacggttggcataccaatcccttcgtt
cccgtgatcaaagagggaaagatctatgcccgcggtacacaggatatgaagagcggtgtg
gctgcttttgtgcaggcggtcaaagagtgtgaagacttttcgggcaggctctccattctg
cttacttcagatgaagaaggcgatgccacctacggcacccagatcatgcttcagcacctt
aaagagattgacctgctccctgatgcctgcatcgtggcggaaccgacctgtgaaacggct
tttggagatgcgatcaaagtgggacggagaggttccgtcaacggcgtgatagaaaaacac
ggcatacagggacatgcagcctacccggagaaagcaaagaatcccattcacaaggtggcg
caggtgcttccaatgatggcgggagtgaaccttgatgagggcgacgaattttttggccca
agtcagttcgttatcaccgacctgcgtgccggtatggaagttaccaatgttacaccggga
aaacttaaaatgatgttcaatgtccgcaactcgactgaaacgactttggaagatgtggag
aaatttgtgcacacctatttcaacggaatggattatgacttgacactcaaacagtctgcc
acaccttttttgacggatcccgaccggccgatcgtacatgccctggatgaaagcattcag
aaagtctgcggcatcacgccaaaacattctacggcaggcgggaccagtgatgcaagattc
atcgcggccgacaacatagatgtcattgaattcggtgtgatcaacgatacgatccatgca
cccaatgagagaacctcgatcgaagaagttgaaaaactgtatgaagttttcaaagaaacg
atcaagtatttcacccaaggataa

DBGET integrated database retrieval system