KEGG   Sulfurovum sp. NBC37-1: SUN_0539Help
Entry
SUN_0539          CDS       T00572                                 

Gene name
pabA
Definition
anthranilate synthase component II (EC:2.6.1.85)
Orthology
K01658  
anthranilate synthase component II [EC:4.1.3.27]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sun01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sun00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
549795..550364
Genome map
AA seq 189 aa AA seqDB search
MVLMIDNYDSFTYNVVQYCRELGADLTVIRNDEMSIDEIKALHPEKIILSPGPSTPDDAG
VTLDVIRNFADTTPIFGICLGHQSIAQAFGGEVIRAKHMMHGKTSQVEVDADTPIFKGLP
EEFRATRYHSLTVNKENLPENIIATSHSKDDEEIMSLQIKDRPVYGVQFHPESIMSEYGH
EMLDNFLKL
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggtattaatgatagacaactatgacagcttcacctataatgtcgtacagtattgccgt
gaactcggagcagacttaacggtgatcaggaacgatgagatgagcattgatgagatcaag
gcactgcatccagaaaagatcatcctctctcccgggccgtccacgcctgatgatgccgga
gtgacacttgatgtcatcaggaattttgccgatactacaccgatcttcggtatctgtctg
ggacaccagagcatcgcccaggccttcggtggagaggtgatccgtgccaaacatatgatg
cacgggaagacatcgcaggtggaggtcgatgccgatacgccgatcttcaaaggcttaccc
gaagaattccgcgcaacgcgctatcactccttgacggtcaacaaagagaatctgcctgaa
aatatcatcgctacttcacacagcaaagatgatgaagagatcatgtccctgcagataaag
gacaggccggtttacggtgtacagttccatcccgaatccatcatgagtgaatacgggcat
gagatgctggacaactttcttaaactctaa

DBGET integrated database retrieval system