KEGG   Sulfurovum sp. NBC37-1: SUN_0539Help
Entry
SUN_0539          CDS       T00572                                 

Definition
(GenBank) anthranilate synthase component II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sun01100  Metabolic pathways
sun01110  Biosynthesis of secondary metabolites
sun01130  Biosynthesis of antibiotics
sun01230  Biosynthesis of amino acids
sun02024  Quorum sensing
Module
sun_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SUN_0539
  Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    SUN_0539
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SUN_0539
Enzymes [BR:sun01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     SUN_0539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 ATP_bind_3
Motif
Other DBs
NCBI-ProteinID: BAF71499
UniProt: A6Q7P0
Position
549795..550364
Genome map
AA seq 189 aa AA seqDB search
MVLMIDNYDSFTYNVVQYCRELGADLTVIRNDEMSIDEIKALHPEKIILSPGPSTPDDAG
VTLDVIRNFADTTPIFGICLGHQSIAQAFGGEVIRAKHMMHGKTSQVEVDADTPIFKGLP
EEFRATRYHSLTVNKENLPENIIATSHSKDDEEIMSLQIKDRPVYGVQFHPESIMSEYGH
EMLDNFLKL
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggtattaatgatagacaactatgacagcttcacctataatgtcgtacagtattgccgt
gaactcggagcagacttaacggtgatcaggaacgatgagatgagcattgatgagatcaag
gcactgcatccagaaaagatcatcctctctcccgggccgtccacgcctgatgatgccgga
gtgacacttgatgtcatcaggaattttgccgatactacaccgatcttcggtatctgtctg
ggacaccagagcatcgcccaggccttcggtggagaggtgatccgtgccaaacatatgatg
cacgggaagacatcgcaggtggaggtcgatgccgatacgccgatcttcaaaggcttaccc
gaagaattccgcgcaacgcgctatcactccttgacggtcaacaaagagaatctgcctgaa
aatatcatcgctacttcacacagcaaagatgatgaagagatcatgtccctgcagataaag
gacaggccggtttacggtgtacagttccatcccgaatccatcatgagtgaatacgggcat
gagatgctggacaactttcttaaactctaa

DBGET integrated database retrieval system