KEGG   Sulfurovum sp. NBC37-1: SUN_0541Help
Entry
SUN_0541          CDS       T00572                                 

Definition
ATP citrate synthase subunit 1 (EC:2.3.3.8)
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
Citrate cycle (TCA cycle)
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sun01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sun00020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
551581..552891
Genome map
AA seq 436 aa AA seqDB search
MAQKAIREYDGKAIFARHWNEYFDGFHYGFKSVLVSSGDELREKAKEHGFEWLNQEPLVA
KPDMLFGKRGKNDLVLFRVEKPGDVTLEDAAKWIDEKQSHDVTLLSGEKGHLTHFIVEPF
TPHTQDQEYYISATTVGEDDVLFMSAEGGMEVEEGWDEKVNEVHIPINMPDADMEKMVKS
HIPADIPDENKTAFASFAIQFFKFYRDMNFAYLEINPIVMLDGGEMAILDLVARLDDTAG
FMMKDAWGDIEFPTAFGMEDMSDEEKAIAEADSKSGASLKLTILNPMGRIWTMVAGGGAS
VVYADTIADFAGVEDLANYGEYSGGPTTGETKFYAETIFDLMTRYDDPRGKVLIIGGAIA
NFTDVAKTFTGIIQAFEIYADKLKEHKTKIYVRRGGPNYEKGLKDIKEAADRLGLYIEVY
GPETHVTDIVRMALEK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaaaagcgattagagagtacgatggtaaagcaatttttgcaagacattggaac
gaatattttgatggtttccattatggattcaaatcagtattagttagcagtggagacgaa
ctgagagagaaagcaaaagaacatggttttgagtggttgaatcaggagccgttggttgca
aagccggatatgttgtttggtaaaagaggtaaaaatgaccttgttctctttagggtagaa
aagccaggcgatgttactctggaagatgctgcaaagtggatcgatgagaagcagtctcat
gatgtaacgctcctctccggagaaaaaggacacttgacacactttattgtagaaccgttc
acaccgcatactcaggatcaggagtattatatttcagctacaactgtcggtgaagatgat
gttctattcatgtcggcagaaggtggtatggaagttgaagaaggatgggatgaaaaagtc
aatgaagtccatattcctatcaatatgcctgatgcagatatggaaaaaatggtcaagtca
catatccctgccgatattcctgacgagaacaaaacggcatttgcatcctttgcgatccag
ttcttcaaattctacagagatatgaacttcgcttaccttgagatcaacccgatcgttatg
cttgacggcggtgaaatggcgatccttgacctggttgcaagactggacgataccgcagga
ttcatgatgaaagatgcatggggtgacatcgagttcccgactgcattcggtatggaggat
atgtccgatgaagaaaaagcgatcgcagaagcggatagcaaatcaggcgcttctctcaag
ctgacgatccttaacccgatgggccgcatctggacaatggtcgccggtggtggtgcgtca
gtagtttatgctgatacaatcgccgactttgccggtgttgaggacctcgcgaactatggt
gaatactcaggcgggccgacaacaggtgaaacaaagttctatgcagaaacgatcttcgat
ctgatgacaagatacgatgaccccagaggaaaagtgcttatcatcggtggtgcgattgcg
aactttaccgatgttgccaaaacatttacgggtatcattcaggcatttgagatctatgcg
gacaagctcaaagagcataagacaaagatctatgtaagacgtggcggaccaaactatgaa
aaagggctgaaggatatcaaagaagctgctgacagattgggtctttatattgaagtttat
gggccggaaacacatgtcactgacattgttagaatggcattagagaagtaa

DBGET integrated database retrieval system