KEGG   Sulfurovum sp. NBC37-1: SUN_0541Help
Entry
SUN_0541          CDS       T00572                                 

Definition
(GenBank) ATP citrate synthase, subunit 1
  KO
K15231  ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun00020  Citrate cycle (TCA cycle)
sun01100  Metabolic pathways
sun01110  Biosynthesis of secondary metabolites
sun01120  Microbial metabolism in diverse environments
sun01130  Biosynthesis of antibiotics
sun01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SUN_0541
Enzymes [BR:sun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     SUN_0541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_bind ATP-grasp_2
Motif
Other DBs
NCBI-ProteinID: BAF71501
UniProt: A6Q7P2
Position
551581..552891
Genome map
AA seq 436 aa AA seqDB search
MAQKAIREYDGKAIFARHWNEYFDGFHYGFKSVLVSSGDELREKAKEHGFEWLNQEPLVA
KPDMLFGKRGKNDLVLFRVEKPGDVTLEDAAKWIDEKQSHDVTLLSGEKGHLTHFIVEPF
TPHTQDQEYYISATTVGEDDVLFMSAEGGMEVEEGWDEKVNEVHIPINMPDADMEKMVKS
HIPADIPDENKTAFASFAIQFFKFYRDMNFAYLEINPIVMLDGGEMAILDLVARLDDTAG
FMMKDAWGDIEFPTAFGMEDMSDEEKAIAEADSKSGASLKLTILNPMGRIWTMVAGGGAS
VVYADTIADFAGVEDLANYGEYSGGPTTGETKFYAETIFDLMTRYDDPRGKVLIIGGAIA
NFTDVAKTFTGIIQAFEIYADKLKEHKTKIYVRRGGPNYEKGLKDIKEAADRLGLYIEVY
GPETHVTDIVRMALEK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaaaagcgattagagagtacgatggtaaagcaatttttgcaagacattggaac
gaatattttgatggtttccattatggattcaaatcagtattagttagcagtggagacgaa
ctgagagagaaagcaaaagaacatggttttgagtggttgaatcaggagccgttggttgca
aagccggatatgttgtttggtaaaagaggtaaaaatgaccttgttctctttagggtagaa
aagccaggcgatgttactctggaagatgctgcaaagtggatcgatgagaagcagtctcat
gatgtaacgctcctctccggagaaaaaggacacttgacacactttattgtagaaccgttc
acaccgcatactcaggatcaggagtattatatttcagctacaactgtcggtgaagatgat
gttctattcatgtcggcagaaggtggtatggaagttgaagaaggatgggatgaaaaagtc
aatgaagtccatattcctatcaatatgcctgatgcagatatggaaaaaatggtcaagtca
catatccctgccgatattcctgacgagaacaaaacggcatttgcatcctttgcgatccag
ttcttcaaattctacagagatatgaacttcgcttaccttgagatcaacccgatcgttatg
cttgacggcggtgaaatggcgatccttgacctggttgcaagactggacgataccgcagga
ttcatgatgaaagatgcatggggtgacatcgagttcccgactgcattcggtatggaggat
atgtccgatgaagaaaaagcgatcgcagaagcggatagcaaatcaggcgcttctctcaag
ctgacgatccttaacccgatgggccgcatctggacaatggtcgccggtggtggtgcgtca
gtagtttatgctgatacaatcgccgactttgccggtgttgaggacctcgcgaactatggt
gaatactcaggcgggccgacaacaggtgaaacaaagttctatgcagaaacgatcttcgat
ctgatgacaagatacgatgaccccagaggaaaagtgcttatcatcggtggtgcgattgcg
aactttaccgatgttgccaaaacatttacgggtatcattcaggcatttgagatctatgcg
gacaagctcaaagagcataagacaaagatctatgtaagacgtggcggaccaaactatgaa
aaagggctgaaggatatcaaagaagctgctgacagattgggtctttatattgaagtttat
gggccggaaacacatgtcactgacattgttagaatggcattagagaagtaa

DBGET integrated database retrieval system