KEGG   Sulfurovum sp. NBC37-1: SUN_0543Help
Entry
SUN_0543          CDS       T00572                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SUN_0543
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SUN_0543
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SUN_0543
Enzymes [BR:sun01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SUN_0543
Exosome [BR:sun04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SUN_0543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(554853..556175)
Genome map
AA seq 440 aa AA seqDB search
MKKISLLLITISFLTAAPKTSVIFMIGDGMGPAYTSAYRYYKDDPKTPKVEPTVFDEMLV
GMNTTYSENSLITDSAAAATALATGYKTKNGFIGATEKPHSQVKTLLEYAKEQGYITAMA
VTSTLTHATPAGFISKEHHRDKEADIAKDFFPATAKEKLKFDFLMGGGEIHFNEAYGDIN
QTAKKHNVALYRNGYDFDSIHNYPFIAFTAYDYAKFAIDEKDENRDRVSKMTQKALSLVE
NKPFFMMIEGSQIDWCGHINDIACAMAEMDDFAKAVEKVKNYVDTHPDTLLIVTADHSTG
GLAIGDKIGKSDKVSDEIRSRSYIWYKDVIKKVKASSITIAEALRTTKNIDKSFENYTGI
DLTDKEYDQLASAMKKKDKKLCNAVNEIINQRSNTGWTTHGHTLVDVETFAYGKSSEKFR
GLLDNTDIAKKLFKVLSAGK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatatcactcttactcatcacaatctcttttttgaccgctgcgccaaaaaca
tccgttatttttatgatcggggacggtatgggaccggcctatacctcagcatatcgctac
tacaaagatgatccgaagacgccaaaagtcgagcctacggtctttgacgagatgctggtc
ggtatgaataccacctattccgaaaattcgcttatcaccgattcggcagcagcagctaca
gcactggcaacaggctacaaaactaagaacggttttatcggagcgactgaaaagccacac
tcacaggtaaaaacacttttagagtatgccaaagaacagggatatatcactgcaatggca
gtgaccagcaccctgacccatgccacccctgcaggattcatttctaaagaacaccacagg
gacaaggaagcggatatcgccaaggatttttttccggcaacagcgaaagagaagctgaaa
tttgattttctcatgggaggtggggagatccattttaatgaagcctatggtgacatcaac
cagacagcaaaaaaacacaatgtagcactttaccgtaacggttatgactttgatagcata
cataactatccgtttattgcatttactgcctatgattatgcaaaatttgccattgacgaa
aaagatgagaacagagaccgtgtatcaaaaatgacgcaaaaagccctttcgcttgtcgag
aacaagccattcttcatgatgatagaaggatcacagatagactggtgcggacatatcaat
gacattgcctgtgcaatggctgagatggatgattttgcaaaagcagtggaaaaagtcaaa
aactatgtagacacccaccctgatacattgctcatcgttacggcagatcattccaccggc
ggcctggcaataggagacaagatagggaaatcggacaaggtttcagacgaaatacgcagc
aggtcatacatctggtataaagatgtgataaaaaaggtcaaagcctcttccattaccata
gccgaagcgttacgcacaacaaaaaatatcgacaaaagcttcgaaaactataccgggatt
gatctgacagataaagaatatgaccaacttgcctctgccatgaaaaagaaggacaagaaa
ctctgcaatgctgtcaatgagatcatcaatcagcgatccaatacaggatggacaacacat
ggacatacccttgtagatgtagagacttttgcctatgggaaaagcagtgaaaagttcaga
ggtttgctagacaatacagatattgcaaaaaaattatttaaagtgttatcagcaggaaaa
taa

DBGET integrated database retrieval system