KEGG   Sulfurovum sp. NBC37-1: SUN_0823Help
Entry
SUN_0823          CDS       T00572                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sun03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
836781..837338
Genome map
AA seq 185 aa AA seqDB search
MIVGMEGIVERRDPTFIHLNVNGIIYEIQVSINTSNAIQEKRVKLFITQVIREDADLLFG
FMDTNEKKMFDTVLKINGVGPKVGLAICSTFTPETFAKVVASKDVSMLKRVPGIGPKAAS
RILVELADFIVDGNAAEGSSGALGEAVMALESLGFKKDAIQKALSGCSGDTSTLVKEGLK
KLQRL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtaggtatggaaggaatagtggagagacgtgatcccacattcattcatttaaat
gtgaacgggatcatctatgaaatacaggtttccatcaatacctctaatgccatacaggag
aagcgtgtaaagcttttcatcactcaggtgatacgggaagatgccgacctgctgttcggt
tttatggataccaatgagaagaagatgttcgatacggtcctgaagatcaatggcgtaggg
cccaaagtagggcttgccatctgttcgacctttacacctgagacctttgccaaagtagtg
gcttcaaaagatgtcagtatgctcaaaagagtacccggtatcggtccgaaagcggccagc
cgtattctggtagagttggcggacttcattgtggacgggaatgcagcagagggtagcagc
ggtgcactgggtgaagcggtcatggcacttgaaagcctcgggttcaagaaagatgccatc
caaaaggcgctttcagggtgttccggcgatacaagtactctggtgaaagagggcttgaag
aagttacagagactataa

DBGET integrated database retrieval system