KEGG   Sulfurovum sp. NBC37-1: SUN_0967Help
Entry
SUN_0967          CDS       T00572                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SUN_0967
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUN_0967
   00620 Pyruvate metabolism
    SUN_0967
   00640 Propanoate metabolism
    SUN_0967
  Energy metabolism
   00680 Methane metabolism
    SUN_0967
Enzymes [BR:sun01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SUN_0967
Lipid biosynthesis proteins [BR:sun01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SUN_0967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
986185..987936
Genome map
AA seq 583 aa AA seqDB search
MEERRIKKNPADFLVQPNMTDYEVTYDSFDWESIAKEFEGLPGGGLNIAHEAIDKHANGA
LAEKAALIWLGENSEKRTYTFAQMKRESAKFANVLKSLGFEKGERVYTLSTRLPELYIGT
MGILKNGSVMCPLFSQFGPEPILQRMQRGDARGLLTTQRLYEKKIAPQMDQLPELRTILL
IDAEEDVNEKVLSLPRLMEKASDSFEIVHTEPEDMSLLHFTSGTTGMPKGVIHVHKAMYT
HWVTGAYVLDLHPDDMYWCTADPGWVTGTSYGIIAPWLHGVTNVVDEAEFDAERWYGILQ
EHKISVWYTAPTAIRRLMRLDIEPLESYDLSHLRLVQSVGEPLNPEAVIWGVEKLKMPIH
DNWWQTETGGIMIANYLCQDVKPGSMGRPLPGIVAAVVRQNGDGTVTEIREPGKDGDLAL
KPGWPSMFRGYLHNEEKYKKSFVDGWYISGDLAYRDEDGYFWFVGRADDIIKTSGHMVGP
FEVESALMEHPAVAEVGVIGKPDPLIGQMVKAFVSLKSGYEPTEKLKRELIGFGRKKLGA
AVAPKEIEFQENLPKTRSGKIMRRLLKARELGLPEGDTSTLEK
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggaagagagacgtatcaaaaaaaatcctgctgattttttagttcagcccaatatgaca
gactatgaggtgacctacgacagttttgactgggagagtatcgccaaagagttcgaaggc
ttgcctggaggcggcctgaacatcgcccatgaagcgatagacaagcatgccaacggtgcg
ctggccgagaaagcggccctgatatggctgggagagaacagcgagaagcgtacctatact
tttgcgcagatgaaacgggagagtgcaaagttcgccaatgtactcaaatcactcggtttt
gaaaaaggagaacgtgtctatacactttcgacgcgtcttcccgaactctatattggaacg
atggggatactcaaaaacggttcggtgatgtgcccgctcttctcccagttcggtcctgaa
ccgatactgcagcggatgcagcgcggcgatgcccgcgggcttctgacgacacagaggctg
tatgagaaaaagatcgctccccagatggaccagcttcccgaactgcgtaccatcctgttg
atcgatgccgaagaggacgtgaacgagaaggtgctttccctgccgcgtctgatggaaaaa
gcgtcggacagtttcgagatcgtgcatacggagccggaagatatgtcactgctgcatttt
accagcggaacgacgggtatgcccaaaggggtgatacatgtccataaggcgatgtacacg
cactgggtgacgggtgcctacgtactggaccttcatcctgacgatatgtactggtgtacc
gccgatccgggttgggtgacgggtacctcctacggcatcatcgcgccctggctgcacggg
gtgaccaatgtcgtggatgaagcggagttcgatgccgaacgctggtacggtattttgcag
gagcacaagatctctgtctggtacaccgcacccacggcgatccgccgtcttatgcgtctc
gatatcgaacctcttgaaagctatgatctttcacatttgcgtctggtacagagtgtcggc
gaacccctcaaccccgaagcggtcatttggggtgtagagaaacttaaaatgccgatccat
gacaactggtggcagacggagacgggcggtatcatgatcgccaactatctctgccaggat
gtcaaaccggggtccatgggacggccgctgccgggtatcgttgccgcggtggtgcgtcag
aacggtgacggaacggtcacggagatcagggaacccggaaaagacggcgacctggcattg
aaaccgggatggccttcgatgttccgcggctatctgcacaatgaagaaaaatataaaaaa
agctttgtggacggctggtatatttcgggtgaccttgcctacagagatgaagacggttac
ttctggttcgttggacgcgcggatgatatcatcaagacttcagggcacatggtcgggccg
ttcgaggtggaaagtgcgctgatggagcatccggcagtggcggaagtcggcgttatcggt
aagcccgatccgctgatagggcagatggtcaaagcctttgtttccctgaaaagcggttat
gaacccaccgaaaagctcaaacgtgaactgatagggttcggacgcaaaaaactgggtgcc
gcggtggcgccaaaagagatagagttccaggagaacctgcccaagacccgaagtgggaag
atcatgcgccgtctgttgaaggccagagagcttggattgccagagggtgatacctcgaca
ctggaaaaataa

DBGET integrated database retrieval system