KEGG   Sulfurovum sp. NBC37-1: SUN_0984Help
Entry
SUN_0984          CDS       T00572                                 

Definition
N-acetyl-beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SUN_0984
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SUN_0984
Enzymes [BR:sun01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SUN_0984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1006759..1008435)
Genome map
AA seq 558 aa AA seqDB search
MHQACRERAGGNETVNPFKKYFMMSPLILMLWICIAVPHILFAQYNINVIIPKPQKLIKG
SGEFQLNKQSRYRSDTPLADNAIRYLQEHLKRNADYSLKKETISTKNTIRFHYNTKKIRK
PEAYRLRIDKEQISIEARDRAGFFYAVISLMQLMDPAIWRNAKGRKIRQWQISSCTIEDY
PRYRWRGMMLDVSRNFFSNAYIKKFIDRMAQQKLNRFHWHLTDDEGWRIEIKKYPLLTKV
GAKRGPGTKLPFSTFPAMRGPKNRIQSGYYTQSDIREIVAYAKARSIEILPEIDMPGHSK
AAITAYSKLLQDPKDKSRYHSVQRVSNNTINPGMDSTYIFLDNVITEVSRLFPFGYIHLG
GDEVPKGAWSGSPAVKELMRKKGLKHTREIQNYFFGRMDSILAKHGKKMIAWQEVLSGKP
RLRQGDIFMAWKSPKAGFKIIKKHRNAIMAPVQYLYFDQQYVRSKKEPGHTWSTPVSTRK
TYSFNPGSSRYLKGVQACLWSETLLNEKIADYLAWPRSFALSEVAWTEQKRRNWKDFRKR
VKNRGLKRLQIQNIHYRP
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
gtgcatcaggcatgcagggagcgtgcgggtggtaacgaaacagtgaatccttttaaaaag
tacttcatgatgtcaccactgatcttgatgctatggatttgtatcgccgtaccgcacatt
ctgtttgcacagtacaatatcaatgtcatcattcccaaaccccagaaactcatcaagggc
agcggtgaatttcaactgaataaacagagtcgttaccgctccgatacccctctagccgac
aatgccatacgctatctgcaggaacatttgaaacggaatgcagattactcactgaaaaaa
gagactatatccacaaaaaataccatccgcttccactacaacaccaaaaagatcagaaaa
cccgaagcctacagactcagaatagacaaagagcagatcagtatcgaagcaagagacagg
gccggttttttctatgcggtcatttcactgatgcagctgatggatccggctatttggcgc
aatgcgaaaggcaggaagatcaggcagtggcagatctcctcctgcaccatcgaggactat
ccgcgttaccgctggcggggcatgatgctcgatgtctcgcgaaacttcttctccaacgcc
tatatcaaaaagttcatagaccgtatggcacagcagaaactcaaccgcttccactggcac
ctgaccgatgatgaggggtggcgcatcgagatcaagaagtatccgctgctcacgaaggta
ggcgcgaagcgcggaccgggaacgaagctgccattctccacttttccagccatgcgcgga
ccgaagaacaggatacagtcagggtactacacccaaagtgacatcagagagatcgtcgcc
tatgccaaagcccgttccatagagatactgccggagatagacatgcccggccacagtaaa
gcggccattacagcctattccaaactgttgcaggaccccaaagacaaaagccgttaccac
tccgtacagagggtcagcaacaatacgatcaaccccggaatggacagcacttacatcttt
ctggacaatgtcattaccgaggtcagcaggctctttcctttcggatacatccatctggga
ggcgacgaagttccaaaaggggcatggagcggatcgcctgcagtgaaggaactgatgcgt
aaaaaaggtttgaagcataccagggaaatacagaattatttttttggcagaatggacagt
atccttgcaaaacacggcaaaaagatgatcgcctggcaggaggttctttcaggaaaaccg
agactgcggcagggtgatatcttcatggcatggaaaagcccaaaagcgggcttcaagatc
ataaagaagcatcgcaatgccatcatggcaccggtacagtacctctacttcgaccagcag
tacgtcagaagcaaaaaagagccggggcacacctggtccacacctgtcagcacaagaaag
acctacagcttcaaccccggaagttcccgctatctcaaaggtgtacaggcctgcctttgg
tcggaaacactactcaatgaaaagatagccgactacctggcatggcccaggagctttgcc
ctctcggaagtggcatggacggagcaaaagaggcggaattggaaggattttcggaagcgg
gttaaaaatagaggccttaagaggttacagatccagaatatccattacagaccataa

DBGET integrated database retrieval system