KEGG   Sulfurovum sp. NBC37-1: SUN_1040Help
Entry
SUN_1040          CDS       T00572                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SUN_1040
Enzymes [BR:sun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SUN_1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1066718..1067218
Genome map
AA seq 166 aa AA seqDB search
MVKRKKLNKDLTLIFTPHFPYNANRNSRMRYRALLGIGGNVGDVLRRFEHFFWYLKDSEF
IHLLESSPILKNPPFGFLEQDDFLNATLLVETDLTPKQLLRYVLRIEKKFGRKRLFKDGP
RTLDIDLIFYEDIRMESRELTLPHPSWMQRASVLIPLSMMKEKVNR
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaagaaaaaaactgaacaaagacctgacattgatttttacccctcattttccc
tataatgcaaacagaaattcccgtatgcgctatagagcgcttctggggatcggcgggaat
gtaggtgatgtactccgccgtttcgagcattttttctggtacctgaaagattctgaattc
attcatttgctggagagctcaccgatactaaaaaatccgccattcggttttctggaacag
gatgattttctgaatgcaacactgcttgtagagaccgatctgacaccaaagcagttactg
cgttatgttcttcggatagaaaagaagtttggtagaaaacgtttatttaaagacggacca
agaacactggatatagacttgatattttatgaggatatcaggatggagagtagagaattg
acacttccgcatccttcttggatgcagagagcatcagtgctgatccctctgtcaatgatg
aaagaaaaggtaaatcgatga

DBGET integrated database retrieval system