KEGG   Sulfurovum sp. NBC37-1: SUN_1150Help
Entry
SUN_1150          CDS       T00572                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun00010  Glycolysis / Gluconeogenesis
sun00620  Pyruvate metabolism
sun00640  Propanoate metabolism
sun00680  Methane metabolism
sun01100  Metabolic pathways
sun01110  Biosynthesis of secondary metabolites
sun01120  Microbial metabolism in diverse environments
sun01130  Biosynthesis of antibiotics
sun01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUN_1150 (acs)
   00620 Pyruvate metabolism
    SUN_1150 (acs)
   00640 Propanoate metabolism
    SUN_1150 (acs)
  Energy metabolism
   00680 Methane metabolism
    SUN_1150 (acs)
Enzymes [BR:sun01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SUN_1150 (acs)
Lipid biosynthesis proteins [BR:sun01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SUN_1150 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: BAF72105
UniProt: A6Q9E6
Position
1176492..1178447
Genome map
AA seq 651 aa AA seqDB search
MSEIYYPKKEMFTDPLIKNMCEYNDLVEEFEKDYEGTWGKYAQEKIDWFKPFDRVLNEDD
APFYKWFEGGELNVAYQCVGRHLKTKKNKAAIIFEGDNGDQRTLTYRELYYEVNRTANLF
RNKFNIKKGDRVVLYMPMIPEAAISMLACAKLGAIHSVVFGGFSAEALRDRIIDAEAKLV
VTADGAFRKGKPYMLKPVVDEALEEGCDCVEAVCVVERNGEDIHWEAGRDYAYNELVENE
SVECEPEMVDSEHPLFLLYTSGSTGKPKGVQHSSAGYILWAQMTMEWVFDIKDNDTYWCT
ADVGWITGHTYIVYGPLAAGATTVMFEGVPTFPDAGRCWKMVEEYQINQFYTAPTAIRLL
HKMGADEPAKYDLSSLRILGTVGEPIDPSAWKWYYEAVGNSNCSIVDTYWQTETGGHMIS
PLPAATPIKPGCATFPLPGIVAEIMEEDGTPTPVGEKGFMCITKPWPSMIRTIWNDPERF
VKSYFGDCKKDGKAVYFTGDGAMMDEDGYITITGRTDDVINVSGHRMGTAEVEAAVKKHD
NVAAVAVVGKPHEIKGEGIFAYVVLKDPHSVADEFAMMKEINTIIKSEIGAIALCDDMAF
VPDLPKTRSGKIMRRILRSLVKGEAITQDTSTLEDPSIVGIIEDILKKECE
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaatatactacccgaaaaaagagatgttcactgatccccttatcaaaaacatg
tgcgagtacaatgatcttgtcgaagagtttgaaaaggactatgaaggaacctggggcaaa
tatgcccaggagaaaatagactggttcaaaccgttcgaccgagtgctgaatgaggatgat
gcaccattctacaagtggttcgaaggcggagagctgaatgtcgcctatcagtgtgtggga
agacacctcaagaccaagaagaacaaagcagcgatcatctttgaaggtgacaacggcgac
cagagaacactgacctaccgtgaactctactacgaggtaaacagaacggcgaacctcttc
aggaacaaattcaacattaaaaaaggcgacagggtcgtgctctatatgccgatgatcccc
gaagcggcgatctccatgcttgcctgtgccaagctcggtgctatccactctgtggtattt
ggtggattctcggctgaagcgctcagagaccgtatcatcgatgcggaagccaaactggtc
gttaccgctgacggtgccttcagaaaaggaaaaccgtatatgctcaagccggttgttgac
gaagcgcttgaagaagggtgcgattgtgtcgaggcggtctgtgttgtcgagcgtaacggt
gaagatatccactgggaagcgggacgcgactatgcctacaatgaactggtagagaatgaa
tccgttgaatgtgagcctgagatggtggattccgagcatccccttttccttctttacact
tcgggaagtaccggaaaaccaaaaggggtccagcattcaagtgcagggtacatcctttgg
gcgcagatgaccatggagtgggtctttgacatcaaagacaacgatacctactggtgtacg
gccgatgtgggctggatcacgggacatacctatatcgtctacgggccgcttgctgcgggt
gcgacaacggtgatgttcgagggtgtaccgaccttccctgatgcgggaagatgctggaaa
atggtggaagagtatcagataaaccagttctatacggcgccgaccgccatcagactcctt
cacaagatgggtgcggacgagccggcaaagtacgacctctcttcactgcgtatccttggg
actgtgggtgagcctattgacccgtcggcctggaaatggtactacgaagcggtgggtaac
tccaactgttccattgtcgatacctactggcagacagaaacaggcgggcatatgatctct
ccactgcctgcggcaacacctatcaagcctggctgtgcgacattcccgcttccgggtatc
gtagctgagatcatggaagaagacggcacaccgacaccggtaggggaaaaaggcttcatg
tgtatcaccaaaccatggccgagcatgatcagaacgatctggaacgatcctgaaagattc
gtgaagtcctactttggcgactgcaagaaagacggcaaagcggtctactttacgggtgac
ggtgcgatgatggatgaggacggttacattaccattaccggacgtactgatgatgtcatt
aatgtctcaggccacagaatgggtacggcagaagtcgaagcggcggtcaagaaacatgac
aatgtcgcagcagtcgcagtagtcggtaaaccgcacgagatcaaaggcgaggggatcttc
gcctatgtggtcctcaaggatccgcatagtgtagcagatgaatttgccatgatgaaagag
atcaatacgatcatcaagtccgagatcggtgccatcgcactgtgtgacgatatggcattc
gtgcccgacctcccgaaaacacggtcaggaaagatcatgagaagaatcctcagaagcctc
gtcaaaggtgaagcgatcacgcaggatacttcaacactggaagatccgagtatcgtgggt
atcatcgaagatattctcaaaaaagagtgtgaatag

DBGET integrated database retrieval system