KEGG   Sulfurovum sp. NBC37-1: SUN_1209Help
Entry
SUN_1209          CDS       T00572                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SUN_1209
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUN_1209
   00020 Citrate cycle (TCA cycle)
    SUN_1209
   00620 Pyruvate metabolism
    SUN_1209
Enzymes [BR:sun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SUN_1209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1242678..1244018)
Genome map
AA seq 446 aa AA seqDB search
MDYKVVMPRLSDSMDEGQLVEWKIRPGDVVRNGDVIAEVESDKAVMEIQIFKSGTVKELL
IDAGSTVPVGTPMAVIDTDVGSGSSVKTEEKSKEQNSTSVSAAQKPTETVPVKEKRPPAV
ETKKAPVETQASVPSAIDILMGISDTSTEEKSSYTGGNASPRARALAAKYGLDIETLQNE
GKLPVPAHSADVKGYWLRRYFTPKALELIARYNLSIDLFEARKKHDEAEIIAYIQSHEVP
LPEPIDMPHKAMIAIVNAAQKRPVYHMTDRIDATLLNHYVSKDLTITVWLLKLFAEAMMR
QKYFRLTLTDDHMQLWPNASISVAMAHGEYLYMPVFKTVNTKNPAAIAEELHQFKTKISQ
KKLTKEDLTGSTFGISNLGMTGIEQFDAMINKDDCAIAAIGSEIEGRITVTLTVDHRIVN
GYQAALFMQELKTLAQDEMFFKEVAQ
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggactacaaggtcgtgatgccccgtctatcggattcgatggatgaaggacaactggta
gaatggaagatccggccgggggatgtggtcaggaacggtgacgtaatcgcagaggtcgag
agcgacaaagcggtcatggagatacagatcttcaaaagcgggacggtaaaagaactgctc
atagatgcgggtagtaccgtgccggtcggaacgccgatggcggtgatcgatacggatgtg
ggctcaggaagcagtgttaaaacggaagaaaaatccaaagagcaaaacagcacgtcagtc
tctgcagcccaaaaacctacagaaaccgtacctgtaaaagagaagcgtcctcctgcagta
gaaacgaaaaaagcacctgttgaaacccaggcatctgtaccaagtgccatcgatatactt
atggggatttctgatacttcaacagaagagaagtcctcctataccggaggcaatgcatcg
ccaagagccagagcgcttgccgcgaagtacggtcttgacattgaaacacttcagaatgaa
ggcaaactgcctgtcccggcacattcggcagatgtaaaaggatattggttgcgtcgctac
tttacccccaaagcacttgaactcatagccaggtacaacctttcgatcgatcttttcgag
gcgcggaagaagcatgacgaagccgagatcatagcctatatccaatcgcatgaagtacct
ctgcccgaaccgatcgacatgccgcacaaagcgatgatagccatcgtgaatgctgcgcag
aaacgtccggtctaccatatgacggaccgtatcgatgccacgttgctgaaccactatgta
tccaaagatctgacgatcacggtctggttgctcaaactctttgctgaagcgatgatgcgg
cagaagtatttccgtttaacattgacggacgatcatatgcaactctggccgaatgcttcc
atctccgttgccatggcccatggcgagtacctctatatgccggtattcaagacagtgaac
acaaagaaccctgcggcgatcgcagaagaactgcatcagttcaagacaaagatctcccaa
aagaaactgacgaaggaggacctgacaggttcgaccttcggaatctccaatctggggatg
accggtattgaacagttcgatgcgatgattaacaaagatgactgtgccatagcggcgatc
ggcagtgagattgagggaaggatcaccgttactctcacggtcgaccatcgcatcgttaac
ggatatcaggcggcattgttcatgcaggaactcaaaacactggcacaggatgaaatgttc
tttaaggaggtagcacaatga

DBGET integrated database retrieval system