KEGG   Sulfurovum sp. NBC37-1: SUN_1209Help
Entry
SUN_1209          CDS       T00572                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun00010  Glycolysis / Gluconeogenesis
sun00020  Citrate cycle (TCA cycle)
sun00620  Pyruvate metabolism
sun01100  Metabolic pathways
sun01110  Biosynthesis of secondary metabolites
sun01120  Microbial metabolism in diverse environments
sun01130  Biosynthesis of antibiotics
sun01200  Carbon metabolism
Module
sun_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUN_1209
   00020 Citrate cycle (TCA cycle)
    SUN_1209
   00620 Pyruvate metabolism
    SUN_1209
Enzymes [BR:sun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SUN_1209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 CAT HlyD_3 E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: BAF72164
UniProt: A6Q9K5
Position
complement(1242678..1244018)
Genome map
AA seq 446 aa AA seqDB search
MDYKVVMPRLSDSMDEGQLVEWKIRPGDVVRNGDVIAEVESDKAVMEIQIFKSGTVKELL
IDAGSTVPVGTPMAVIDTDVGSGSSVKTEEKSKEQNSTSVSAAQKPTETVPVKEKRPPAV
ETKKAPVETQASVPSAIDILMGISDTSTEEKSSYTGGNASPRARALAAKYGLDIETLQNE
GKLPVPAHSADVKGYWLRRYFTPKALELIARYNLSIDLFEARKKHDEAEIIAYIQSHEVP
LPEPIDMPHKAMIAIVNAAQKRPVYHMTDRIDATLLNHYVSKDLTITVWLLKLFAEAMMR
QKYFRLTLTDDHMQLWPNASISVAMAHGEYLYMPVFKTVNTKNPAAIAEELHQFKTKISQ
KKLTKEDLTGSTFGISNLGMTGIEQFDAMINKDDCAIAAIGSEIEGRITVTLTVDHRIVN
GYQAALFMQELKTLAQDEMFFKEVAQ
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggactacaaggtcgtgatgccccgtctatcggattcgatggatgaaggacaactggta
gaatggaagatccggccgggggatgtggtcaggaacggtgacgtaatcgcagaggtcgag
agcgacaaagcggtcatggagatacagatcttcaaaagcgggacggtaaaagaactgctc
atagatgcgggtagtaccgtgccggtcggaacgccgatggcggtgatcgatacggatgtg
ggctcaggaagcagtgttaaaacggaagaaaaatccaaagagcaaaacagcacgtcagtc
tctgcagcccaaaaacctacagaaaccgtacctgtaaaagagaagcgtcctcctgcagta
gaaacgaaaaaagcacctgttgaaacccaggcatctgtaccaagtgccatcgatatactt
atggggatttctgatacttcaacagaagagaagtcctcctataccggaggcaatgcatcg
ccaagagccagagcgcttgccgcgaagtacggtcttgacattgaaacacttcagaatgaa
ggcaaactgcctgtcccggcacattcggcagatgtaaaaggatattggttgcgtcgctac
tttacccccaaagcacttgaactcatagccaggtacaacctttcgatcgatcttttcgag
gcgcggaagaagcatgacgaagccgagatcatagcctatatccaatcgcatgaagtacct
ctgcccgaaccgatcgacatgccgcacaaagcgatgatagccatcgtgaatgctgcgcag
aaacgtccggtctaccatatgacggaccgtatcgatgccacgttgctgaaccactatgta
tccaaagatctgacgatcacggtctggttgctcaaactctttgctgaagcgatgatgcgg
cagaagtatttccgtttaacattgacggacgatcatatgcaactctggccgaatgcttcc
atctccgttgccatggcccatggcgagtacctctatatgccggtattcaagacagtgaac
acaaagaaccctgcggcgatcgcagaagaactgcatcagttcaagacaaagatctcccaa
aagaaactgacgaaggaggacctgacaggttcgaccttcggaatctccaatctggggatg
accggtattgaacagttcgatgcgatgattaacaaagatgactgtgccatagcggcgatc
ggcagtgagattgagggaaggatcaccgttactctcacggtcgaccatcgcatcgttaac
ggatatcaggcggcattgttcatgcaggaactcaaaacactggcacaggatgaaatgttc
tttaaggaggtagcacaatga

DBGET integrated database retrieval system