KEGG   Sulfurovum sp. NBC37-1: SUN_1234Help
Entry
SUN_1234          CDS       T00572                                 

Definition
cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sun  Sulfurovum sp. NBC37-1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1267213..1268235
Genome map
AA seq 340 aa AA seqDB search
MKIIKFMGMSLLASSLLLGAASVADKAKNAGLKAIPADKAELMKLIDPKNTITPERVELG
KKLYFEPRLSKSGIISCNTCHNIGLGGVDGVPAATGHNWTANPHHLNSPTVYNAVFFDKQ
FWDGRSPDLEDQAQGPMQAAPEMAAAPSLVEARVNSIPAYVDEFKKAYGKDVKVDFVTIT
KTIGIFERTLVTPSRFDDYLNGKEDALSDAEKAGLATFIDKGCTSCHTGIALGGSMQPFP
AVGKFKYANVGDFKGDKNGMVKAPTLRNITETAPYFHNGTVWDLKEAVKIMGETQLGMKI
SDEDAAKIVTFFKALDGKKPEIVYPQFPESTLKTPKPDFK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcattaaatttatgggaatgtcgttgttggcatcttcactgctgcttggtgca
gcatcggttgcagacaaagccaaaaatgcgggattaaaagcgatccctgcggacaaagca
gagctgatgaagctgatcgatccgaagaataccatcacgcctgaaagagttgaactgggc
aagaaactctatttcgaaccaagactctcaaagagcggtatcatttcatgtaatacctgt
cacaacattggtcttggcggtgtagacggtgtacctgccgcgacaggccacaactggacg
gcaaacccgcatcacctcaattcgccgacagtctacaatgcggtattcttcgacaaacag
ttctgggacggacgaagcccagaccttgaggaccaggcacagggtcctatgcaggctgca
cctgaaatggctgcagcaccttcactggtagaagcaagagtcaattccatccctgcgtat
gtggatgaattcaaaaaagcgtacggaaaggatgtcaaagtagattttgtcactatcact
aaaaccatcggtatctttgaaagaacacttgtaacaccttcaagattcgatgactacctc
aacgggaaagaagatgcgttgagcgatgccgaaaaagcaggtcttgctacattcatcgac
aaaggatgtacttcctgccatacaggtatcgctctgggcggaagtatgcagccattccct
gcagttggaaagttcaaatatgccaacgtaggtgacttcaagggtgacaagaacggtatg
gtcaaagcaccgacactgagaaacattaccgaaacagcaccttatttccataacggtact
gtatgggatctgaaagaagcggtcaagatcatgggtgaaacacagcttggaatgaagatc
tccgatgaagatgctgccaagatcgtgacattcttcaaggcactcgatgggaaaaaacct
gagatcgtttaccctcagttcccggaaagtacactcaaaacaccaaagccagacttcaag
taa

DBGET integrated database retrieval system