KEGG   Sulfurovum sp. NBC37-1: SUN_1268Help
Entry
SUN_1268          CDS       T00572                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SUN_1268 (glgB)
Enzymes [BR:sun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SUN_1268 (glgB)
Exosome [BR:sun04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SUN_1268 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1294728..1296653)
Genome map
AA seq 641 aa AA seqDB search
MLHTMHYDVSRFKPLDIYLFKEGTHTKLYEKFGSHFMRSKGRSGVYFAVWAPNAKRVSVV
ADFNAYDERAHPLKMRDDDSGIWEGFIENVKEYVTYKYHIVSNYHNIVNLKTDPYAKYCE
KPSNSASVTYKLQGYRWKDSDWMERRADFNGHDKPMSIYEVHLGSWRRKVEEGNRYLTYS
ELADELVAYVREMGYTHVELMPITEYPFKGSWGYQVTGYFAPTARYGKPKEFMKLVDTLH
RNGIGVILDWVPSHFVTDGHGLATFDGTCLYEHRDPRLGFQPQWGSAVFNYSRNEVRAFL
ISSASFWFEKYHIDGIRVDAVASMLYLDYGREAGEWLPNREGGRENLEAIDFLKQLNLSV
YGEFKDIVMIAEESTAYPMVSKPVHLGGLGFGFKWNMGWMHDTLKYFALNPVYRQHHQDD
LTFSIWYAFDENFVLPLSHDEVVHMKGSLINKMAGDDNQKFANLRALYTYMMAHPGKKLL
FMGGEFAQYREWDYESSLDWHLLESPRHRGIHTMLKELNQLYKNEKALYQYDSEHAGFEW
VERSDNLHNTISFFRKSDNVDETVIVVCNFADRTREDYRVAVPKEGKYKMIFNSQNSRYE
GWSHDSESIYESEKHLAWDREDSISFTMPALGVVYFKLIVE
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgcttcatacaatgcactatgacgtgtcccggttcaagccgctggatatctatctattt
aaagagggaacccataccaagctttatgagaaattcggttcccattttatgagaagcaaa
ggcaggagcggtgtttactttgccgtctgggctcccaatgccaaacgggtcagtgtcgta
gccgacttcaatgcctatgatgagcgggcacatccgttgaaaatgagagacgatgactca
gggatatgggaaggcttcattgaaaatgtgaaggagtatgtgacatacaaatatcatatt
gtctcaaattaccacaacatcgtaaacctaaagacggatccgtatgccaaatattgtgaa
aagccctccaattcggcctctgtcacctacaagcttcaaggctaccgatggaaggacagt
gactggatggagaggagagccgacttcaatgggcatgacaaacctatgagcatttatgaa
gtacatctgggttcctggagaagaaaggtggaggagggcaaccgctaccttacctacagc
gaattggcagacgaactggttgcgtatgtcagggagatgggctatacccatgtagaactg
atgcctattacggaatacccgttcaagggttcctggggctatcaggtcacgggatatttt
gctccgacggcacgttacggaaaacccaaagaatttatgaaactggtagatacgctgcac
cggaacggcataggcgtgatactcgactgggtaccctcacactttgtcacggacggccat
ggccttgcgacatttgacggaacctgtctgtatgagcatcgggatcccagactggggttt
cagccgcagtggggcagtgcggtcttcaattacagcaggaatgaggtacgtgctttcctg
ataagcagtgcttcgttctggttcgagaagtatcatatcgacggtatcagggtggatgct
gtggcttccatgctttatcttgactacggtagagaagcgggggagtggctgcccaacaga
gaaggcggcagggaaaatctcgaagccatcgactttttaaaacagctgaacctgtcagtg
tatggtgaattcaaggatatcgtgatgatcgcagaggaatccaccgcctatccgatggtc
agcaagccggtccatctcggcggtctggggttcgggttcaaatggaatatgggatggatg
cacgatacgctgaaatattttgcgctgaaccctgtctacaggcagcatcatcaggatgac
ctgaccttcagcatctggtatgcgttcgatgaaaatttcgtactgccattaagccacgac
gaggtcgtacatatgaaaggttccctgattaacaagatggcgggagatgacaaccagaaa
tttgcgaaccttagagctttatatacctacatgatggcgcatccgggtaaaaaactgctt
ttcatgggtggagaatttgcccagtaccgggagtgggactatgaaagctcactcgactgg
catctgcttgagagtccgagacatagagggattcacacaatgttgaaggagctgaaccag
ttatataaaaatgaaaaagccctctatcagtatgatagtgaacatgccggatttgaatgg
gtggaacgctctgacaatctgcacaataccatctctttcttccgaaaaagcgacaatgtc
gatgagacggtcatcgtggtatgcaactttgcagacagaacgagagaggactatagagtt
gctgttcccaaggagggtaagtacaaaatgatcttcaattcgcagaacagcagatatgaa
gggtggagtcatgacagtgaaagtatttatgagagtgaaaaacatttggcgtgggacaga
gaagattctatcagcttcactatgccggcactcggtgttgtctatttcaaattaattgta
gaatga

DBGET integrated database retrieval system