KEGG   Sulfurovum sp. NBC37-1: SUN_1268Help
Entry
SUN_1268          CDS       T00572                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun00500  Starch and sucrose metabolism
sun01100  Metabolic pathways
sun01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SUN_1268 (glgB)
Enzymes [BR:sun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SUN_1268 (glgB)
Exosome [BR:sun04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SUN_1268 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: BAF72221
UniProt: A6Q9R2
Position
complement(1294728..1296653)
Genome map
AA seq 641 aa AA seqDB search
MLHTMHYDVSRFKPLDIYLFKEGTHTKLYEKFGSHFMRSKGRSGVYFAVWAPNAKRVSVV
ADFNAYDERAHPLKMRDDDSGIWEGFIENVKEYVTYKYHIVSNYHNIVNLKTDPYAKYCE
KPSNSASVTYKLQGYRWKDSDWMERRADFNGHDKPMSIYEVHLGSWRRKVEEGNRYLTYS
ELADELVAYVREMGYTHVELMPITEYPFKGSWGYQVTGYFAPTARYGKPKEFMKLVDTLH
RNGIGVILDWVPSHFVTDGHGLATFDGTCLYEHRDPRLGFQPQWGSAVFNYSRNEVRAFL
ISSASFWFEKYHIDGIRVDAVASMLYLDYGREAGEWLPNREGGRENLEAIDFLKQLNLSV
YGEFKDIVMIAEESTAYPMVSKPVHLGGLGFGFKWNMGWMHDTLKYFALNPVYRQHHQDD
LTFSIWYAFDENFVLPLSHDEVVHMKGSLINKMAGDDNQKFANLRALYTYMMAHPGKKLL
FMGGEFAQYREWDYESSLDWHLLESPRHRGIHTMLKELNQLYKNEKALYQYDSEHAGFEW
VERSDNLHNTISFFRKSDNVDETVIVVCNFADRTREDYRVAVPKEGKYKMIFNSQNSRYE
GWSHDSESIYESEKHLAWDREDSISFTMPALGVVYFKLIVE
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgcttcatacaatgcactatgacgtgtcccggttcaagccgctggatatctatctattt
aaagagggaacccataccaagctttatgagaaattcggttcccattttatgagaagcaaa
ggcaggagcggtgtttactttgccgtctgggctcccaatgccaaacgggtcagtgtcgta
gccgacttcaatgcctatgatgagcgggcacatccgttgaaaatgagagacgatgactca
gggatatgggaaggcttcattgaaaatgtgaaggagtatgtgacatacaaatatcatatt
gtctcaaattaccacaacatcgtaaacctaaagacggatccgtatgccaaatattgtgaa
aagccctccaattcggcctctgtcacctacaagcttcaaggctaccgatggaaggacagt
gactggatggagaggagagccgacttcaatgggcatgacaaacctatgagcatttatgaa
gtacatctgggttcctggagaagaaaggtggaggagggcaaccgctaccttacctacagc
gaattggcagacgaactggttgcgtatgtcagggagatgggctatacccatgtagaactg
atgcctattacggaatacccgttcaagggttcctggggctatcaggtcacgggatatttt
gctccgacggcacgttacggaaaacccaaagaatttatgaaactggtagatacgctgcac
cggaacggcataggcgtgatactcgactgggtaccctcacactttgtcacggacggccat
ggccttgcgacatttgacggaacctgtctgtatgagcatcgggatcccagactggggttt
cagccgcagtggggcagtgcggtcttcaattacagcaggaatgaggtacgtgctttcctg
ataagcagtgcttcgttctggttcgagaagtatcatatcgacggtatcagggtggatgct
gtggcttccatgctttatcttgactacggtagagaagcgggggagtggctgcccaacaga
gaaggcggcagggaaaatctcgaagccatcgactttttaaaacagctgaacctgtcagtg
tatggtgaattcaaggatatcgtgatgatcgcagaggaatccaccgcctatccgatggtc
agcaagccggtccatctcggcggtctggggttcgggttcaaatggaatatgggatggatg
cacgatacgctgaaatattttgcgctgaaccctgtctacaggcagcatcatcaggatgac
ctgaccttcagcatctggtatgcgttcgatgaaaatttcgtactgccattaagccacgac
gaggtcgtacatatgaaaggttccctgattaacaagatggcgggagatgacaaccagaaa
tttgcgaaccttagagctttatatacctacatgatggcgcatccgggtaaaaaactgctt
ttcatgggtggagaatttgcccagtaccgggagtgggactatgaaagctcactcgactgg
catctgcttgagagtccgagacatagagggattcacacaatgttgaaggagctgaaccag
ttatataaaaatgaaaaagccctctatcagtatgatagtgaacatgccggatttgaatgg
gtggaacgctctgacaatctgcacaataccatctctttcttccgaaaaagcgacaatgtc
gatgagacggtcatcgtggtatgcaactttgcagacagaacgagagaggactatagagtt
gctgttcccaaggagggtaagtacaaaatgatcttcaattcgcagaacagcagatatgaa
gggtggagtcatgacagtgaaagtatttatgagagtgaaaaacatttggcgtgggacaga
gaagattctatcagcttcactatgccggcactcggtgttgtctatttcaaattaattgta
gaatga

DBGET integrated database retrieval system