KEGG   Sulfurovum sp. NBC37-1: SUN_1270Help
Entry
SUN_1270          CDS       T00572                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SUN_1270
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUN_1270
   00052 Galactose metabolism
    SUN_1270
   00500 Starch and sucrose metabolism
    SUN_1270
   00520 Amino sugar and nucleotide sugar metabolism
    SUN_1270
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SUN_1270
   00524 Butirosin and neomycin biosynthesis
    SUN_1270
Enzymes [BR:sun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SUN_1270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1298131..1298955)
Genome map
AA seq 274 aa AA seqDB search
MSKLYIDIGGTYLRSELLKNGKTFKEKVSSRGISLSEYLEQKLGAYPDIAEIGISFAGQV
DHGKIVSSPNIAVKEYDIKKYIEKKYPVSLKIDNDLNCAMLAEKEDIKRKNMALLYIGTG
MGSAVLEQGEIVRGERNLAYEIGHVPFKKAPFRCGCGKDNCLELFSSGSGLKKWYTYYGL
PQMTLEELRKSKDKYAKKIYQNFQEGLFRAAATLVTLANPKVLVLGGGVVSANHFLKEKV
EKKIGKYALASNLEGLEIKLSQLKNASIEGAKQL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaaactctatatagatataggcggaacctacctgagaagcgaactgcttaaaaat
ggaaaaacattcaaagagaaagtgtcaagccgggggatatctttgagcgaatacctcgaa
caaaagttaggagcctatcctgacatagcagagatcgggatctcctttgccggtcaggta
gaccatggaaagatagtttcctctccgaatattgcagttaaagaatatgatattaaaaaa
tatattgaaaagaaatacccggtatccctgaaaatagacaatgatctcaactgtgcgatg
ctcgcagaaaaagaggatataaagagaaaaaatatggcactgttatacataggtacaggt
atggggtccgccgttctggagcagggtgaaattgtaaggggtgagcgaaatctggcatat
gagatagggcatgtaccttttaaaaaggcaccgttccggtgcggctgcggcaaagacaac
tgtctggagcttttcagcagcggcagcgggttgaaaaagtggtatacctattacggactc
ccccaaatgactttggaagaattgagaaagtctaaagacaagtatgcgaagaagatatat
cagaactttcaggaaggtctgttccgggcggctgctacacttgtgacgctggcaaatccg
aaagtcctggtacttggcggaggtgtcgtttctgccaatcattttttgaaagagaaggta
gaaaagaagatcggaaaatatgcgctggcctcaaacctggaaggcttggagataaagctg
agtcaattaaaaaatgcatcaatagaaggagcaaaacaattatga

DBGET integrated database retrieval system