KEGG   Sulfurovum sp. NBC37-1: SUN_1548Help
Entry
SUN_1548          CDS       T00572                                 

Definition
(GenBank) acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun00270  Cysteine and methionine metabolism
sun00920  Sulfur metabolism
sun01100  Metabolic pathways
sun01110  Biosynthesis of secondary metabolites
sun01120  Microbial metabolism in diverse environments
sun01200  Carbon metabolism
sun01230  Biosynthesis of amino acids
Module
sun_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SUN_1548
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SUN_1548
Enzymes [BR:sun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     SUN_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: BAF72499
UniProt: A6QAJ0
Position
complement(1601657..1602235)
Genome map
AA seq 192 aa AA seqDB search
MIKTYRQLKYYWYADEIRNFGRKRKLYFKLRDLRYRLLFLLRACNHLYNKKKSNILMKGI
RKIVCYLYARTQLKLGCEIDPKTDIKEGLFLPHPNGIIIHHKAKIGKNCTILQQVTIGNN
ANKGLEDIASIGMNVSIGAGAKIIGACEIGNNIIIGANAVVVKNIHDNSVVGGVPARYIS
DNVPPAYNAYYE
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaacatatagacaactcaaatattattggtatgccgatgaaattagaaacttt
ggaagaaagagaaaactatatttcaaacttagagatttaagatataggcttttgttttta
ttaagggcatgtaaccatttatataacaaaaaaaaatcaaatatacttatgaaaggaata
agaaagattgtatgttatttgtatgcaagaacacagttgaagctcggatgtgaaatagat
ccaaaaactgatattaaggaagggctatttctccctcatccaaatggaattattattcat
cataaagcaaaaattggtaaaaactgtacgatattacagcaagtgacgataggaaataat
gccaataaaggattggaagacatagcatctataggtatgaatgtttctattggagcagga
gcaaaaattattggagcatgtgaaattggtaataatattattataggagcaaatgcagta
gtggtaaaaaatattcatgataatagtgtagttggaggagtgcctgccagatacataagt
gataatgtgcctcctgcatataatgcctattatgaataa

DBGET integrated database retrieval system