KEGG   Sulfurovum sp. NBC37-1: SUN_1548Help
Entry
SUN_1548          CDS       T00572                                 

Definition
acetyltransferase
Orthology
K00640  
serine O-acetyltransferase [EC:2.3.1.30]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SUN_1548
   01230 Biosynthesis of amino acids
    SUN_1548
  Energy metabolism
   00920 Sulfur metabolism
    SUN_1548
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SUN_1548
Enzymes [BR:sun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     SUN_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1601657..1602235)
Genome map
AA seq 192 aa AA seqDB search
MIKTYRQLKYYWYADEIRNFGRKRKLYFKLRDLRYRLLFLLRACNHLYNKKKSNILMKGI
RKIVCYLYARTQLKLGCEIDPKTDIKEGLFLPHPNGIIIHHKAKIGKNCTILQQVTIGNN
ANKGLEDIASIGMNVSIGAGAKIIGACEIGNNIIIGANAVVVKNIHDNSVVGGVPARYIS
DNVPPAYNAYYE
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaacatatagacaactcaaatattattggtatgccgatgaaattagaaacttt
ggaagaaagagaaaactatatttcaaacttagagatttaagatataggcttttgttttta
ttaagggcatgtaaccatttatataacaaaaaaaaatcaaatatacttatgaaaggaata
agaaagattgtatgttatttgtatgcaagaacacagttgaagctcggatgtgaaatagat
ccaaaaactgatattaaggaagggctatttctccctcatccaaatggaattattattcat
cataaagcaaaaattggtaaaaactgtacgatattacagcaagtgacgataggaaataat
gccaataaaggattggaagacatagcatctataggtatgaatgtttctattggagcagga
gcaaaaattattggagcatgtgaaattggtaataatattattataggagcaaatgcagta
gtggtaaaaaatattcatgataatagtgtagttggaggagtgcctgccagatacataagt
gataatgtgcctcctgcatataatgcctattatgaataa

DBGET integrated database retrieval system