KEGG   Sulfurovum sp. NBC37-1: SUN_1624Help
Entry
SUN_1624          CDS       T00572                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun00260  Glycine, serine and threonine metabolism
sun00750  Vitamin B6 metabolism
sun01100  Metabolic pathways
sun01110  Biosynthesis of secondary metabolites
sun01120  Microbial metabolism in diverse environments
sun01230  Biosynthesis of amino acids
Module
sun_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SUN_1624 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SUN_1624 (thrC)
Enzymes [BR:sun01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SUN_1624 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: BAF72574
UniProt: A6QAR5
Position
complement(1679912..1681378)
Genome map
AA seq 488 aa AA seqDB search
MQFIETRGNDGKKPSSVQFSEAILSPSASFGGLYVPQTLPELDKDFLTSHLSSHYKTLAL
DFLDRFGIDIAKEVLESAVNRYDGFDDPENPVPVVQIENDCFVSELYHGQTRAFKDMALQ
PFGYILSKTAQKRGENYLIMAATSGDTGPATLETFKNQANIKVACLYPDGGTSDVQRLQM
VTEDAENLKVIGVKGNFDDTQHALKELLASDDFKAELEARGIKLSAANSVNFGRIIFQII
YHIHSYLELIRQKAVSMGEEVYMVVPSGNFGNALGAYYAKKAGLPVKKILIASNINNILT
DWINTGIYDISDRELILTESPAMDILKSSNIERVMFDKFGAERTKELMEELNMNKRFALT
SEELVSLQEDFSATYSSDEEGEAVIAEYAGKGYIMDPHTATCLKAYENLREEKIPTILYS
TAEWTKFSTTVAKALGHPVENDLEALAWVSQNANVTVPSMINDLFSKPVIHNIIVKKEDI
KGEMLNFL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttattgagacacggggaaatgacgggaagaagccgtcatccgtacagttttca
gaagcgatactcagcccgagtgccagttttggaggactttacgttcctcaaacacttccg
gagctggataaagattttttaaccagccatctttccagccactataaaactctggcgctc
gattttctcgacagatttggcatcgatattgccaaagaggtacttgaatcagccgtgaac
cgttatgacggttttgacgatcccgaaaacccggtaccggtggttcagatcgaaaatgac
tgtttcgtctctgagctttaccatgggcagacacgtgccttcaaagacatggcattgcag
cctttcggatacattctgagcaaaacggcacagaagagaggcgagaactatctgatcatg
gcggctaccagtggagatacagggcctgcaacgcttgaaacgttcaagaaccaggcgaac
atcaaggtagcatgtctctacccggatggagggacttccgatgtccagagactgcaaatg
gtcactgaagatgccgaaaacctcaaagtgatcggtgtcaaagggaacttcgatgacaca
cagcatgcgctgaaagaactgctggcttctgacgatttcaaagcggaactcgaagcacgc
ggtatcaaactttccgcggccaattccgtaaactttggacgtatcattttccagatcatt
taccatatccactcctaccttgaactgatcagacagaaagctgtttccatgggcgaagag
gtctatatggtcgttccgagcgggaacttcgggaatgcgctgggtgcatactatgccaag
aaagcgggtctgcctgttaagaagatactgattgcttccaatatcaacaacatcctgact
gactggatcaatacaggtatctacgatatcagcgacagagagctgatcctgaccgaatcg
cctgctatggatattctgaagagttccaatatcgaacgtgtgatgttcgacaagttcggt
gccgagcggaccaaagagctgatggaagagctgaatatgaacaaaaggtttgcgttgact
tcagaagagctggtatcgctccaggaagatttttctgcaacatactcgagtgacgaggaa
ggtgaagctgtgatcgcggaatatgccggaaaagggtacattatggacccacatacggca
acctgtcttaaagcctatgaaaacctgagagaagagaagataccgacgatcctctactcc
acggctgaatggacaaagttcagtacaacggtagccaaagcacttggacatccggttgaa
aatgacctcgaagcgctggcatgggtatcgcagaatgccaatgttacggtgccttccatg
atcaatgaccttttcagcaaaccggtaattcataatataattgtaaagaaagaggatata
aaaggagagatgttgaacttcctgtag

DBGET integrated database retrieval system