KEGG   Sulfurovum sp. NBC37-1: SUN_1627Help
Entry
SUN_1627          CDS       T00572                                 

Definition
cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sun  Sulfurovum sp. NBC37-1
Brite
Enzymes [BR:sun01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     SUN_1627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1685557..1686483)
Genome map
AA seq 308 aa AA seqDB search
MKFTNIFLLTFLVFSMVLSAPIKPLPQSVKVDRKKVVLGHKLFFDPRLSQDGTVSCASCH
DLENGGDDGRKFSIGVGGKRGNINSPTVYNAVFNFRQFWDGRAEDLKAQVFGPIENPVEM
NMTMAQTVDTLKKDPMYVSEFAKVYSDGITQENVADAIAEYEKTLITPNAPFDRYLKGEK
NAISPEVEEGYKLFESKGCIVCHNGINVGGNFYNKFGIFKDANSSALGRYNITKREEDKY
VFKVPSLRNVALTAPYMHDGRAHTLKEAVEIMSEHQLGRYMTEDEIMKIVAFLKSLTGEI
PQSVKKRN
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttacaaacatttttttactgactttcttagtattcagtatggtgttgtctgct
cctatcaaaccgcttccccaaagtgtgaaagtagatcgcaaaaaggtagttttaggacat
aagctttttttcgatccccgtttgtcacaggacgggacagtttcctgtgccagctgtcat
gatcttgaaaatggaggagatgatggccggaaattctctataggtgtgggtggaaagagg
ggaaatatcaactctcccaccgtttacaatgccgtctttaatttccgtcaattctgggat
ggccgtgccgaagatcttaaagcacaggtcttcggaccgatagagaatcccgtagaaatg
aatatgaccatggcgcagaccgtggatacattgaaaaaagatccgatgtatgtttcggag
ttcgcaaaggtttattctgatggcattacgcaggagaatgtagccgatgccattgcggag
tatgaaaaaacgcttattacacccaacgcaccttttgaccgctatctaaaaggagaaaag
aatgctataagcccggaggtcgaagagggatacaaactcttcgagtccaaaggatgtatc
gtctgccataacggtatcaatgtaggagggaatttttataacaagttcggtattttcaaa
gatgccaacagcagtgccctgggacgttacaacattaccaaacgggaagaggacaaatat
gtctttaaggtaccgtcactgagaaatgtggccttgactgctccctatatgcatgacggc
cgggcacatacgctcaaagaggctgttgagattatgtcggagcaccagcttggcaggtat
atgacggaggatgagatcatgaagatcgttgcctttctcaagtcattaacaggtgagata
cctcaaagtgtcaaaaagaggaactga

DBGET integrated database retrieval system