KEGG   Sulfurovum sp. NBC37-1: SUN_1781Help
Entry
SUN_1781          CDS       T00572                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sun01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sun00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1834254..1835027)
Genome map
AA seq 257 aa AA seqDB search
MKRIVIKVGSHVLTEDGSIARERMMALVELIADLKKHSYEVALVSSGAVAAGYTQLPLDR
DDIANRQALAAIGQPLLLKMYQEKFARFDLLCSQVLFSADVFESDKHVSHAKVAIDTLLA
NNVVPIINENDTVSIEELVFGDNDRLSAHVAHYFDADLLVILSDIDALYDKDPNCFQDAR
RRAVVNEIEEEELAAEHTPNNEFATGGIVTKLQAADFLMKHGREMFLASGFELSDVKSFL
IEGEHKGGTLFTSTKRS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggatcgtgatcaaggtaggttcccatgtcctgacggaagacgggagtatcgcc
agagagagaatgatggcactggttgagcttatcgctgacctgaagaaacacagctatgaa
gtggcgctggtgagttccggtgcggtagcagcaggatatacgcaactcccacttgacaga
gatgacatagccaacagacaggcactggctgccataggccagccgctactgcttaaaatg
tatcaggaaaaattcgcgagatttgatctgctgtgctcccaggtgcttttcagtgcagat
gtgtttgaatctgataaacatgtttcccatgctaaagtggctatcgatacactattggca
aataatgtagtgcctattatcaatgaaaatgataccgtgagtatcgaagaactggtattt
ggtgataacgacaggctttccgcgcatgttgcacactattttgatgcagatcttctggtg
atactttccgatatcgatgcgctgtatgacaaagaccctaactgctttcaggatgccaga
cgccgagccgtagtcaacgagatagaagaagaagaactcgctgcagagcataccccgaac
aatgaatttgctacgggaggaatagttacaaaacttcaggcagccgattttttaatgaag
catggccgggagatgttcctcgcctctggtttcgagctgagtgatgtgaaatctttcctc
atagagggtgagcataaaggcgggacactgttcacatccacaaagaggtcataa

DBGET integrated database retrieval system