KEGG   Sulfurovum sp. NBC37-1: SUN_1877Help
Entry
SUN_1877          CDS       T00572                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sun03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1933347..1933916)
Genome map
AA seq 189 aa AA seqDB search
MKNYKIEAFENLVEAFGSFPSIGKKSAIRLAYHSVMEDGFAAMKLAHAIETAVNSIHKCS
KCHNMSEDELCSICSDPYRDTAKLCIVQSAKDILTIEESGQFDGVYYVISEVRDLDEAHL
FYAVEGVEEIIFAFPPSIATDTMILYIEDKLQGLPISFTKIAQGVPTGVELENIDIMSLS
RALEARVKI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactataaaatagaagcctttgagaacctggtggaagcctttggttctttcccg
tccatagggaagaaatccgctatccgtctggcctaccactctgttatggaagatggcttt
gccgcaatgaaactggctcatgccatcgagacagcggtcaacagtatacacaagtgcagc
aagtgccataacatgagcgaagacgagctctgcagcatctgttcagacccttatcgtgat
acggccaaactctgtatcgttcagagtgcaaaagatattcttaccattgaagagagcggg
cagttcgacggggtttattatgttatctccgaagtgcgtgacctggatgaagcgcatctt
ttctatgcggtagaaggagtggaggagatcatcttcgctttcccgccgagtatcgctacg
gatacgatgatcctttatattgaagacaaactgcagggactgccaatcagtttcacgaag
atcgcacagggggtgcctacgggtgtggagttggaaaatatagacattatgtcactctcg
cgtgcgcttgaggcgagagtgaaaatataa

DBGET integrated database retrieval system