KEGG   Sulfurovum sp. NBC37-1: SUN_1892Help
Entry
SUN_1892          CDS       T00572                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun00860  Porphyrin and chlorophyll metabolism
sun01100  Metabolic pathways
sun01110  Biosynthesis of secondary metabolites
sun01120  Microbial metabolism in diverse environments
Module
sun_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SUN_1892
Enzymes [BR:sun01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SUN_1892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: BAF72839
UniProt: A6QBI0
Position
complement(1947055..1947696)
Genome map
AA seq 213 aa AA seqDB search
MSAQKEIYLLSPTPRTDTISLPMIQFSTVADSIDFDSCDTLMFTSKQAVVTADNVDKKWK
NYPCIAIGAATKKQIEALGGEVIYHPDSYYGETLSQDIIRHFSQRKILYLRPREVSFDSK
AFLKKAGIDLQEQIIYETGCISYSSKEKPVQNAIIIFTSPSTIHCFMKNFDWDESYTAVV
IGRATKVHLPEDANYVVAEEPLISSCIEKAKSL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgcaaaaagaaatctatcttctgtccccgacacccagaacagataccatttct
ctgccgatgatccagttttctacggtagcggacagtatagattttgacagttgcgataca
ctgatgttcacttccaaacaggcggttgttacggctgacaatgtcgataaaaagtggaaa
aattacccctgtatcgccattggtgcggcaacaaagaaacagattgaagcccttggagga
gaggtgatatatcatccggattcctattacggagaaacactcagccaggatattatcaga
catttttcccaaagaaagatcctttaccttcgtcccagggaagtttcttttgattccaaa
gcgtttctgaaaaaagcggggatcgatctgcaggagcagatcatttatgagacgggatgt
atctcttactcatccaaagaaaaacctgtgcaaaatgccattattatttttacttctccc
tctacaatccactgttttatgaaaaactttgactgggatgaaagttatactgccgtggtc
atagggagggcgacaaaagtacacctgcccgaggatgccaattatgtcgtggcggaggaa
cctctgatctcctcctgtattgaaaaagcgaaatcactttaa

DBGET integrated database retrieval system