KEGG   Sulfurovum sp. NBC37-1: SUN_1934Help
Entry
SUN_1934          CDS       T00572                                 

Gene name
cpsG
Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUN_1934 (cpsG)
   00030 Pentose phosphate pathway
    SUN_1934 (cpsG)
   00051 Fructose and mannose metabolism
    SUN_1934 (cpsG)
   00052 Galactose metabolism
    SUN_1934 (cpsG)
   00500 Starch and sucrose metabolism
    SUN_1934 (cpsG)
   00520 Amino sugar and nucleotide sugar metabolism
    SUN_1934 (cpsG)
  Nucleotide metabolism
   00230 Purine metabolism
    SUN_1934 (cpsG)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SUN_1934 (cpsG)
Enzymes [BR:sun01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     SUN_1934 (cpsG)
    5.4.2.8  phosphomannomutase
     SUN_1934 (cpsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1999569..2000993
Genome map
AA seq 474 aa AA seqDB search
MPINKSIFREYDIRGIYNKELNEQSVKLIGYHLGQKIGKGKAVSIGYDARSHSPVLRDYL
TSGLNAAGCTVLDMGMVATPVNYFSNYQKIEDLNPKTPHSSLLTPHLEASPDTSIMITGS
HNPSEYNGFKITLDKTPFFGEDIYTLGDAIIADQARIVPDDTEKIDIDVKTPYINFMIKE
FSHLKGLDKKIVIDCGNGVADTVITDIFDALQFNYTGLYCEPDGTFPNHHPDPSVEKNLA
DVKAALKKEGDIAFAYDGDADRIAVLTHKHNIKGDQMALLYAMKMENPTVIGEVKCSQVM
YDELERRGAKAIMYKTGHSNLKVKMKETNADLACEVSGHIFFKNRYFGYDDAIYATLRML
ELIAEGIDLDKEIEALPTVYSTEELNVETTEEEKFAIIDKVKELLINPPADFPVIKSIID
VDGVRINFDKGWGLVRASNTTPVLVTRFESTDETLAKEYEEKVNQLIESAKVLL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaacaaatccatctttcgtgaatacgatatcaggggcatctacaacaaagag
ctcaacgaacaatctgtaaaactcataggctaccacctgggacagaagattggtaaaggc
aaggcagtatccatcggttacgatgccaggtcacactcccctgttttaagagattatctc
acctcaggactcaacgcagcaggctgtacagtacttgacatgggcatggtagccactccg
gtaaactactttagtaactatcaaaagatcgaagatctcaacccaaaaacccctcactcc
tcactcctcactcctcacttggaagcatcccccgacacttccattatgataacgggatca
cataatccttccgaatataacggcttcaagatcacccttgataaaacacctttctttggt
gaggatatttacacactcggagacgccataatcgccgatcaggccaggattgtgcctgac
gatacagagaagatcgatatcgatgtcaagaccccttacatcaattttatgatcaaagag
ttcagccatctaaagggcctggacaagaagatcgtcatcgactgtggcaacggcgtggca
gatacggttattacagatatattcgatgctctacagttcaactataccgggctctattgt
gaaccggacggtactttcccaaaccatcacccggacccttcggtagaaaagaatcttgcc
gatgttaaagctgctttgaaaaaagagggggacatcgcttttgcctatgacggtgatgcc
gaccgtatcgcggtactgacgcacaaacacaacatcaaaggcgaccagatggcactgctt
tatgccatgaagatggaaaaccctaccgttatcggagaagtcaaatgttcacaggtcatg
tatgatgagcttgaacgacgcggggccaaagccatcatgtacaaaaccggccactcgaac
ctcaaagtcaaaatgaaagagaccaatgcggaccttgcctgcgaggtcagcggccatatc
ttcttcaagaaccgctattttggctatgacgatgccatctatgccacgttgcgtatgctt
gagctcatcgctgagggtatagacttagacaaagagatagaagcactcccgactgtctac
tcgaccgaggagctaaacgtagagaccacggaagaagagaaattcgccatcatcgacaaa
gtcaaagaactgcttataaaccctcctgcagatttccctgtcatcaagagcatcatcgac
gtggacggtgtacgcatcaactttgacaaaggatggggcctggtaagggcttccaacacc
actcccgtacttgtcacccgttttgaatcaacagatgaaacattggcaaaagagtatgaa
gagaaagtcaatcaattaatagagagtgcaaaagtattattatga

DBGET integrated database retrieval system