KEGG   Sulfurovum sp. NBC37-1: SUN_1936Help
Entry
SUN_1936          CDS       T00572                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun00040  Pentose and glucuronate interconversions
sun00052  Galactose metabolism
sun00500  Starch and sucrose metabolism
sun00520  Amino sugar and nucleotide sugar metabolism
sun01100  Metabolic pathways
sun01130  Biosynthesis of antibiotics
Module
sun_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SUN_1936 (galU)
   00052 Galactose metabolism
    SUN_1936 (galU)
   00500 Starch and sucrose metabolism
    SUN_1936 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SUN_1936 (galU)
Enzymes [BR:sun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SUN_1936 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Smr
Motif
Other DBs
NCBI-ProteinID: BAF72883
UniProt: A6QBM4
Position
2002339..2003166
Genome map
AA seq 275 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKATPKEMLPVLTKPLIQYGVEEALEAGITTMAVVTGRGKR
AIEDHFDISYELEHQIKGTSKEPLLNEIRELIAQCTFSYTRQTEMKGLGHAILTGETLIG
NEPFAVILADDLCNNNGNDPVLKQMVAVYEKYQCSVIAIEEVPMDQTDKYGIIAGNLVDN
TDDTYRVTDMVEKPDPEDAPTNMAIIGRYILTPDIFNILRNTQPGKGGEIQITDALLEQA
KQGKVIAYKFKGKRFDCGSVNGFVEATNYFYRNLH
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgatcaaaaaatgtctattccctgctgcaggatatggaacccgttttctccctgctaca
aaggccacccccaaagagatgctccctgtcctcaccaagcctcttatacaatatggtgtt
gaagaagcacttgaggctggtatcactactatggctgttgttacaggtcgagggaaacgt
gcgatagaagaccactttgacatctcatacgaactggaacatcagatcaaaggtacctcc
aaggaaccactgctcaatgagatccgtgaactcattgcccaatgtaccttttcctatacc
agacaaacagagatgaaaggtttgggacatgccatccttacgggggaaacactcatagga
aacgaaccttttgccgtcattcttgcagatgacctctgtaacaacaatggaaatgaccct
gtactgaaacaaatggtggcagtttatgaaaaatatcaatgttctgttatagccatcgaa
gaagtacctatggatcaaaccgacaaatacggcatcattgccggaaaccttgttgacaat
actgatgacacttacagagtgacagatatggtagaaaaaccggaccctgaagatgcaccg
accaatatggccatcatcggacgttacatcctcacacccgatattttcaatattttgcgt
aatacccagccgggtaaaggcggggagatccagattaccgatgcactgcttgagcaggca
aaacagggaaaggtcattgcctataaattcaaaggcaagcgttttgactgtggttcggtt
aatggatttgttgaggctacgaattatttttatcgaaatttacattaa

DBGET integrated database retrieval system