KEGG   Sulfurovum sp. NBC37-1: SUN_2202Help
Entry
SUN_2202          CDS       T00572                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SUN_2202 (tpiA)
   01230 Biosynthesis of amino acids
    SUN_2202 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUN_2202 (tpiA)
   00051 Fructose and mannose metabolism
    SUN_2202 (tpiA)
   00562 Inositol phosphate metabolism
    SUN_2202 (tpiA)
Enzymes [BR:sun01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SUN_2202 (tpiA)
Exosome [BR:sun04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SUN_2202 (tpiA)
  Exosomal proteins of bladder cancer cells
   SUN_2202 (tpiA)
  Exosomal proteins of melanoma cells
   SUN_2202 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2301266..2301955)
Genome map
AA seq 229 aa AA seqDB search
MIFAANFKMNHTRASTKAYLDALNQKLASKRSEDRVFVFPPSTALDHYDGDFTIGAQNAY
LEKNGAFTGEIGLDQLDEFAIKTILIGHSERRDILGEDQAFVAEKFSYFKSQGFEIIYCI
GEALEVREAGEEAVMVHLLSQFEGIDLSYEKMIVAYEPIWAIGTGHSATTEAIASTHAAL
KQHFDRPLLYGGSVKPANIKEITAIESVDGVLVGSASLEVESFTQMIFA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgatctttgcagccaattttaaaatgaatcatacacgtgcatcaaccaaagcatatctg
gatgctttgaatcagaaattggcttcaaaacgcagtgaagaccgtgtgtttgtctttcct
ccttcaacggcacttgaccattatgatggtgacttcacaatcggtgcacagaacgcttat
ctggagaagaatggtgcctttactggtgagattggcctcgatcagcttgacgaattcgct
atcaaaaccattctcatcggacatagtgaacggcgtgatattttgggtgaagatcaggca
tttgtggctgaaaagttctcctatttcaaatcacagggttttgagatcatctactgtatc
ggcgaggctttggaggtaagggaagcaggagaggaagccgtgatggtacatcttctttcc
cagttcgaagggattgacctcagttatgagaaaatgatcgttgcttacgaaccgatctgg
gcgatcggtacgggacactccgccacaacagaagcgatcgcctctacccatgctgcactc
aaacagcattttgacagaccacttctatatggtggttccgtaaagccggcaaacattaaa
gaaattactgctatcgagagtgtggatggtgttttggtgggttctgcttctctggaggtg
gagagttttacgcagatgatctttgcataa

DBGET integrated database retrieval system