KEGG   Sulfurovum sp. NBC37-1: SUN_2210Help
Entry
SUN_2210          CDS       T00572                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun00230  Purine metabolism
sun01100  Metabolic pathways
Module
sun_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SUN_2210 (gmk)
Enzymes [BR:sun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SUN_2210 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_29 RsgA_GTPase ABC_tran MMR_HSR1 AAA_18 AAA_16 T2SSE Rad17 AAA_33 AAA AAA_22 Zeta_toxin Cytidylate_kin AAA_30 AAA_17 APS_kinase CPT NTPase_1 AAA_23 AAA_21 RNA_helicase DUF2611
Motif
Other DBs
NCBI-ProteinID: BAF73150
UniProt: A6QCE1
Position
complement(2307765..2308376)
Genome map
AA seq 203 aa AA seqDB search
MHKGAILVLSGPSGAGKSTIINAASDEIGEYYFSISTTTRDPRMGEQDGVDYFFVSKEEF
EEDIKAGNFLEYAQVHGNYYGTSLKPVNKALEQGKLVIFDIDIQGHRLVRAKMDDITTSA
FITPPTLKELEARLRARCTDDEEVILRRISNAKEEIRAVGEYDFTIINDTVEEAAQKFII
VAKAARLKQSREDEEKFIQRWLG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaggtgcgatactagttctttcggggccaagcggtgcaggtaagagtacgatc
atcaatgcggcatccgatgagataggggagtattatttctccatttccacgacgacaagg
gacccccgtatgggggaacaggacggtgtggactatttcttcgtcagtaaagaggaattc
gaagaagacatcaaagcgggaaattttctggagtatgcccaggtacacggcaattattac
ggtacatcactcaaaccggttaacaaggcactggagcaggggaagttggtcattttcgat
atcgatatacaggggcatcggctggtacgggcgaagatggacgatatcaccacctccgcc
tttatcacgccgcctacgctgaaagaacttgaagcaagactacgggcacgctgtacggat
gatgaagaggtgatcctcagacgtatttcgaatgcaaaagaggagatccgtgcggtcggc
gagtatgattttacgatcataaacgatacagtggaagaggcggcacagaaattcattatt
gtcgcaaaagcggcgaggctcaagcagagcagggaagatgaagagaaattcatacagcgg
tggctgggataa

DBGET integrated database retrieval system