KEGG   Sulfurovum sp. NBC37-1: SUN_2400Help
Entry
SUN_2400          CDS       T00572                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sun  Sulfurovum sp. NBC37-1
Brite
Enzymes [BR:sun01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SUN_2400 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2494756..2495391
Genome map
AA seq 211 aa AA seqDB search
MIKARNRQHLVSEIDKHFLLDEHVKEAFLNVDREAFVPKEFKHLSYNLDALPLAASQWIS
SPLTVAKVTQHLELKGVDSVLEVGCGSGYQAAILSKICRRVFTIERIDELLKEAKAKFSQ
LEIHNIFTRFDDGQRGWKQYAPFERILFSATAKEVPEVLFEQLAEGGILIAPIEQGPDYH
IITRFYKKNGRITSETIEPCLFVPVLDGTQK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagcaaggaaccggcagcatcttgtctcggaaatagataaacattttctactg
gatgaacatgtcaaagaagcatttttgaatgtagacagagaagcctttgtacccaaagag
ttcaaacacctttcctacaatcttgatgccctccctctggcggcaagccagtggatctcc
tcacccctgaccgttgcaaaagtgacacagcatctcgagctcaaaggggtagactccgta
cttgaggtcggttgtgggagcggctaccaggcggcaatcctcagcaagatctgtcgaagg
gtctttactatcgaacgtatcgatgaactcctcaaagaagccaaagccaaattctcccag
cttgaaattcacaatatcttcacccgtttcgacgacggacagcgcggatggaaacagtat
gcaccttttgaacgcatcctcttctccgcaacggcaaaagaggtccccgaagtactcttc
gaacagctggcagaaggcggcatactcattgcacctatagaacaggggccggactaccac
atcattacacgtttctacaaaaagaacgggcgcatcacttccgaaaccatagaaccctgt
ctttttgtacccgtacttgacggtacacagaagtaa

DBGET integrated database retrieval system