KEGG   Streptococcus suis SS12: SSU12_0359Help
Entry
SSU12_0359        CDS       T02025                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
suo  Streptococcus suis SS12
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:suo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
376323..377831
Genome map
AA seq 502 aa AA seqDB search
MTNRTSGILMHITSLPGKFGIGTFGQSAYDFVDFLVETKQTYWQILPLTTTSYGDSPYQS
FSAIAGNTHLIDFDLLVEDGLLATEDFQDVNFGDNPEKVDYALIYQVRRPILEKAVQAFL
QDDKKKAAFLEFEKANSSWLTDYAEFMAIKEYFGNKALQEWEDKKVVARNEEALDKYRLE
LANQIDYYKVTQYFFFSQWKQLKEYANKHHIKIIGDMPIYVSADSVEVWTKPQLFKLDSE
RKPLYVAGVPADNFSADGQLWGNPIYDWPEHEKTGYNWWIYRIHESFKLYDVLRIDHFKG
FSDFWQVDGKAEVAKVGTWEPGPGYNLFKAVKETLGDLPIIAEDLGNIDAKARKLLADCG
YPGMKILEFGFFDVTGKSIDAPHRCIPNSVAYTGTHDNEVVNGWYNNLDPEQQEYVDAYS
NRKPIEKVSQAMLRMLFATVSDTAIATMQDVLDLGEESRMNMPSTIGGNWEWRMKAEDLT
QERKDFLTKMTLLYQRGNENHD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcgtaccagtggaattttgatgcatattacctcacttccaggtaagtttggt
attggtacttttggacagtctgcctatgattttgtagatttcttggtggaaaccaagcaa
acctactggcagattttaccactaacaactacaagctatggagattctccttaccagtct
ttctctgctattgcaggaaatacacacttgatagactttgacctcttggttgaagatggc
ttattggcaacagaagatttccaagatgtaaattttggagataatcctgaaaaagtagac
tatgctcttatctatcaagttcgtcgaccaattttggagaaggcagttcaagcattttta
caagatgataagaagaaagctgcttttctagagtttgaaaaggctaactcatcttggttg
acagattatgcggagttcatggctatcaaggaatactttggtaataaagctctccaagaa
tgggaagataaaaaagttgtagctcgcaatgaggaagctcttgataagtaccgcttagaa
ttggcaaatcaaatcgactactacaaagtcacacagtatttcttcttcagccaatggaaa
caattgaaagaatatgccaacaaacaccacatcaaaatcatcggagatatgccaatctat
gtttctgctgatagcgttgaagtgtggacaaaaccccaactattcaaattggacagtgaa
cgcaagccgctttatgtagcaggtgtaccagctgataacttctcggcagatggtcaatta
tggggaaatcctatttacgattggccagaacatgaaaaaacaggctataactggtggatt
tatcgtatccatgaaagtttcaaactttatgatgtccttcggattgaccatttcaaaggt
ttctcagacttctggcaagttgatggtaaggcagaggtggcaaaagttggaacttgggaa
ccaggtcctggctacaatctcttcaaggctgtcaaagaaacacttggagaccttccaatc
attgcagaagaccttggaaacattgacgctaaagctcgcaaattgcttgcggattgtggc
tatccaggcatgaaaatcttagaatttggtttctttgatgtaacaggtaagagtatcgat
gctccacaccgttgcattccaaattcagttgcctacactggaactcacgataatgaggtt
gtcaatggctggtacaacaatcttgatccagaacaacaagaatacgtggatgcctacagc
aaccgtaagccgattgaaaaagttagccaagctatgctccgtatgctgtttgcaacagtg
agtgatacagctatcgcaaccatgcaagacgtcctagacttgggagaagaaagtcgaatg
aatatgccgtcaactatcggtggaaactgggaatggcgcatgaaagctgaagacttgacc
caagaacgcaaagacttcttgacaaaaatgacattactataccaacgaggaaatgaaaac
catgactaa

DBGET integrated database retrieval system