KEGG   Streptococcus suis SS12: SSU12_0386Help
Entry
SSU12_0386        CDS       T02025                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
suo  Streptococcus suis SS12
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:suo00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
404213..404839
Genome map
AA seq 208 aa AA seqDB search
MKERGLLIVFSGPSGVGKGTVRKEIFESSDNKFEYSVSMTTRPQRPGEVDGVDYFFRSRE
EFEDLIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVKKKVPDGVF
IFLTPPDLEELQDRLIGRGTDSEEVIAQRIERAKEEIALMREYDYAVVNDEVPLAAERVK
RIIEAEHFRVDRVIGRYDEMIREQIVER
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagcgaggcttactcattgtcttttctggtccatctggtgttggaaaaggaaca
gttcgaaaggaaatttttgaaagctctgataataaatttgaatattctgtatccatgacg
acacgtccacagagaccgggagaagttgatggagttgactatttcttccgtagtcgtgag
gaatttgaagatttgattcgccagggtcaaatgttggaatatgcagagtacgttggaaat
tactatggaacacctctgacctatgtcaatgaaactcttgataagggaattgatgtcttt
ttagaaattgaagtacagggtgccctccaagtgaagaaaaaggttccagatggggtgttc
attttcttgacaccacctgacttggaggagttgcaagatcgcttgattggtcgcggaacg
gatagtgaggaagttattgctcaacgtatcgaacgtgccaaggaagagattgccttgatg
cgtgagtatgattatgcagttgtgaacgatgaagttccgttggctgctgagcgtgtcaag
cgtataatcgaagcagaacatttccgtgtagaccgagtgattggtcgctacgatgaaatg
attcgtgaacagatagtagaacgataa

DBGET integrated database retrieval system