KEGG   Streptococcus suis SS12: SSU12_0417Help
Entry
SSU12_0417        CDS       T02025                                 

Definition
galactose mutarotase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
suo  Streptococcus suis SS12
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:suo00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:suo00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
438254..439255
Genome map
AA seq 333 aa AA seqDB search
MIEVKTFDEKAKLYCLENKNGMQVTLTDFGARVVEVLLPVEENGGLRNVSLAAKSDDDYR
KTDLYPGSTIVPVAGRISGAQAEIEGTSYHFTENEPGRTLHGGVDTANEQYWDVELDHER
NQVTFGMVLKDGFNGFPGDVRVKAIYCLTDKNELTVDYQAVSDKDTIFNPTNHIYFNLTG
DFQRSVAEHRIKIAANHYAPLGEDNLPTGVLEDVTGTPFDFRDFAPFAQGFDSQYPQNVL
VKGYDHPWLLEEVDIPVEVLSPDGKIGLSVKTNQPAVVIYTYNFPVEALACYHGVFSLEC
QALPNACNVDGFGSILLEQGEEFLSKTTYRFTW
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagtaaaaacatttgatgaaaaagcaaaactgtattgcttggaaaacaagaat
gggatgcaggtaaccttgacggattttggtgccagagtggtggaagtgcttttgccagta
gaagaaaatggcggtctacggaatgtcagtttagctgccaagtcggatgatgattaccgt
aagacagatttgtaccctggttcaactattgtcccagtagcggggcgtatttcaggtgcc
caagctgagatagagggaacaagctaccatttcacagaaaatgaacctggtaggactcta
cacggtggggttgacacggcaaatgagcagtactgggacgttgagctagaccatgagaga
aatcaagtgacctttggtatggtcctaaaagatggttttaatggctttcctggtgatgtg
agggtcaaggctatttattgtttgacggataaaaatgaattgacagttgactaccaggct
gtatcggataaggatacgatttttaatccgaccaaccatatctatttcaacttgactggt
gattttcaacggtcagttgccgagcaccgtattaaaattgctgccaatcactatgctccg
cttggggaggataacctgccaacgggtgtcttagaagatgtgacagggacgccgtttgat
tttagagattttgcgccttttgctcagggatttgatagccaatatcctcaaaatgtgttg
gtaaaaggctatgaccacccatggttattggaagaggtggatattccggtagaagttttg
agtccagatgggaaaattggactcagtgtcaaaaccaaccagcctgcggtcgttatttat
acatataattttcctgttgaagctttggcctgttaccatggtgtctttagtttagagtgt
caggccttgccaaatgcatgcaatgtcgatggatttggttcgattttgttagaacaagga
gaagaatttttgtctaaaacgacctatcgttttacttggtaa

DBGET integrated database retrieval system