KEGG   Streptococcus suis SS12: SSU12_0602Help
Entry
SSU12_0602        CDS       T02025                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
suo  Streptococcus suis SS12
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:suo00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:suo00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
629799..630278
Genome map
AA seq 159 aa AA seqDB search
MSIYDFTVQKQDGTDQSMAEYQGQVLLIVNTAPGCGLAPQYKELQELYDSYKDNGFVVLD
FPCNQFLNQAPGSAEDINQICSLNYGTTFPRFAKIAVNGSEASPLYRYLKKEKSTLLGGR
IEWNFTKFLVDRQGRVVKRYLPTTSPLKLKEDIELYLEK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttatgattttacagtacaaaaacaagatggcacagaccagtccatggctgag
tatcaaggacaagttttacttatagtcaatacagcgccaggttgtggattggcaccacaa
tacaaggaactacaggagctatatgatagctataaagacaacggttttgtagtgttggat
ttcccttgtaatcaatttttaaatcaggctcccggttctgcggaagacatcaatcagatc
tgtagcttgaattatggtacaacttttcctcgttttgctaaaattgctgtgaatggatct
gaagctagtccgctatatcgctatcttaagaaagaaaaatcaaccttattaggaggtcga
attgagtggaattttaccaagtttttggtggatagacaagggcgtgtggtcaaacgatat
ttaccaacaactagtccattaaaacttaaagaggatattgaactttacctagaaaaataa

DBGET integrated database retrieval system