KEGG   Streptococcus suis SS12: SSU12_0674Help
Entry
SSU12_0674        CDS       T02025                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
suo  Streptococcus suis SS12
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:suo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SSU12_0674 (glpK)
Enzymes [BR:suo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SSU12_0674 (glpK)
Exosome [BR:suo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSU12_0674 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
701449..702963
Genome map
AA seq 504 aa AA seqDB search
MSTEKYIMAIDQGTTSSRAIIFNKKGEKVGSYQKEFTQIFPKPGWVEHNANEIWNSVQSV
IAGSFIESGVRPDQIEGIGITNQRETTVVWDKETGLPIYNAVVWQSRQTAHIADQLKADG
HADMIHQKTGLVVDAYFSATKVRWILDQVPGAQERAEKGEILFGTIDTWLVWKLTDGKCH
VTDYSNAARTMLYNIEELKWDDEILSLLNIPKAMLPEVRSNSEVYGTTAPFHFYGAEVPI
SGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIVMNTGEEMQLSQNNLLTTIGYGIGGKVY
YALEGSIFIAGSAVQWLRDSMRMVTTSPESEELARKSTSNDEVYVVPAFTGLGAPYWNSD
ARGSVFGLTRGTTKEDFVKATLQSIAYQVRDVIDTMQLDTGIDISVLKVDGGAAMNSLLM
QFQADILGIEIARAQNLETTALGAAFLAGLAVGFWKDLDELKELNAVGQSFQPTMNEARK
EQLYKGWKKAVAATQLFAEVDEEQ
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtctactgaaaaatatatcatggccattgaccaaggaactacaagttcacgtgccatt
atcttcaataaaaaaggtgaaaaggttggcagttaccaaaaagagtttacgcaaattttc
cctaaaccaggttgggttgaacacaacgccaatgaaatttggaattctgttcagtctgtg
attgcagggtcctttatcgaaagcggtgttcgtcctgatcagattgaaggaattggtatt
accaaccagcgtgaaacaaccgttgtctgggataaggaaacaggtcttccaatctacaat
gccgttgtctggcaatctcgtcaaacagctcatattgctgaccagctgaaggcggatggt
catgcagatatgattcatcaaaagacaggtctagtagtcgacgcctacttctcagcaacc
aaagttcgttggattttagatcaagtccctggagcgcaggaacgtgctgaaaaaggtgag
attctctttggaaccattgatacttggttggtttggaaattgactgatgggaaatgccat
gtgacggattattcaaacgcagctcgtaccatgctctacaacattgaagagttgaaatgg
gatgatgaaattttatctcttctcaatattccaaaagccatgctgccagaagttcgttca
aactctgaagtttacggcacaacagctccattccatttctatggcgcagaagtgccaatc
tctggcatggcaggtgaccaacaggctgccttatttggacaattagcatttgagccaggt
atggtgaaaaatacttacggaaccggttccttcatcgtgatgaatacaggtgaagagatg
cagttgtcacagaacaaccttctcacaacaattggctatggtatcggtggcaaagtctat
tatgcgcttgaaggatctatctttatcgctggttcggcggttcaatggctccgtgacagc
atgcgaatggtgactacatcacctgagtcagaagagcttgctcgtaagtctaccagcaat
gatgaagtctatgttgttccagcctttacaggacttggtgctccgtattggaactcagat
gcgcgtggctcagtctttggtctcactcgtggtacgactaaagaagacttcgtcaaagca
actcttcaatccattgcctaccaagttcgagatgttattgacaccatgcaattggataca
ggtattgatatttctgtcttgaaggttgacggtggtgcagcaatgaacagcctcctcatg
caattccaagcagatattttgggtattgaaatcgcacgcgctcaaaaccttgaaactaca
gctcttggagcagcattcttagcaggtttagcagttggtttctggaaagatttggatgaa
ttgaaagaactcaacgctgtcggccaatccttccaaccaaccatgaacgaagctcgtaaa
gaacaactttacaagggatggaaaaaagctgtcgcagcaactcaactatttgcagaagtg
gatgaagagcaataa

DBGET integrated database retrieval system